| General Information |
| MoonProt ID | 4039 |
| First appeared in release | 4.0 |
| Name(s) | glucotransferase UgtP |
| UniProt ID | P54166 |
| GO terms | GO:0005515 protein binding ; GO:0016740 transferase activity ; GO:0016757 glycosyltransferase activity ; GO:0016758 hexosyltransferase activity ; GO:0035251 UDP-glucosyltransferase activity ; GO:0047228 1,2-diacylglycerol 3-glucosyltransferase activity ; GO:0047228 1,2-diacylglycerol 3-glucosyltransferase activity ; GO:0006629 lipid metabolic process ; GO:0009246 enterobacterial common antigen biosynthetic process ; GO:0009247 glycolipid biosynthetic process ; GO:0070395 lipoteichoic acid biosynthetic process ; GO:0005886 plasma membrane ; GO:0016020 membrane |
| Organisms for which functions have been demonstrated | Bacillus subtilis (strain 168) |
| Sequence length | 382.0 |
| FASTA sequence | ">sp|P54166|UGTP_BACSU Processive diacylglycerol beta-glucosyltransferase OS=Bacillus subtilis (strain 168) OX=224308 GN=ugtP PE=1 SV=1
MNTNKRVLILTANYGNGHVQVAKTLYEQCVRLGFQHVTVSNLYQESNPIVSEVTQYLYLK
SFSIGKQFYRLFYYGVDKIYNKRKFNIYFKMGNKRLGELVDEHQPDIIINTFPMIVVPEY
RRRTGRVIPTFNVMTDFCLHKIWVHENVDKYYVATDYVKEKLLEIGTHPSNVKITGIPIR
PQFEESMPVGPIYKKYNLSPNKKVLLIMAGAHGVLKNVKELCENLVKDDQVQVVVVCGKN
TALKESLSALEAENGDKLKVLGYVERIDELFRITDCMITKPGGITLTEATAIGVPVILYK
PVPGQEKENANFFEDRGAAIVVNRHEEILESVTSLLADEDTLHRMKKNIKDLHLANSSEV
ILEDILKESEMMTAKQKAKVLS" |
| Structure Information |
| PDB ID | NA |
| Quaternary structure | NA |
| SCOP | |
| CATH | |
| TM Helix Prediction | no TM helices |
| DisProt Annotation | |
| Predicted Disorder Regions | |
| Connections to Disease |
| OMIM ID | |
| Function 1 |
| Function description | enzyme, glucosyltransferase, |
| References for function | _ |
| E.C. number | EC 2.4.1.34 |
| Location of functional site(s) | |
| Cellular location of function | membrane |
| Comments | |
| Function 2 |
| Function description | bind FtsZ, inhibits FtsZ ring formation in cell division |
| References for function | Weart RB, Lee AH, Chien AC, Haeusser DP, Hill NS, Levin PA. A metabolic sensor governing cell size in bacteria. Cell. 2007 Jul 27;130(2):335-47. doi: 10.1016/j.cell.2007.05.043. PMID: 17662947; PMCID: PMC1971218. |
| E.C. number | |
| Location of functional site(s) | |
| Cellular location of function | cytoplasm |
| Comments | |