| General Information |
| MoonProt ID | 4046 |
| First appeared in release | 4.0 |
| Name(s) | phosphoglucose mutase ; GPM1 |
| UniProt ID | P82612 |
| GO terms | "GO:0003824 catalytic activity ; GO:0004619 phosphoglycerate mutase activity ; GO:0004619 phosphoglycerate mutase activity ; GO:0004619 phosphoglycerate mutase activity ; GO:0004619 phosphoglycerate mutase activity ; GO:0005515 protein binding ; GO:0016853 isomerase activity ; GO:0016868 intramolecular phosphotransferase activity ; GO:0006094 gluconeogenesis ; GO:0006096 glycolytic process ; GO:0044406 adhesion of symbiont to host ; GO:0051701 biological process involved in interaction with host ; GO:0061621 canonical glycolysis ; GO:0098609 cell-cell adhesion ; GO:0005739 mitochondrion ; GO:0005829 cytosol ; GO:0005737 cytoplasm ; GO:0005739 mitochondrion ; GO:0005758 mitochondrial intermembrane space ; GO:0005829 cytosol ; GO:0009277 fungal-type cell wall ; GO:0009277 fungal-type cell wall ; GO:0009986 cell surface ; GO:0009986 cell surface ; GO:0030446 hyphal cell wall ; GO:0062040 fungal biofilm matrix" |
| Organisms for which functions have been demonstrated | Candida albicans (strain SC5314 / ATCC MYA-2876) (Yeast) |
| Sequence length | 248.0 |
| FASTA sequence | ">sp|P82612|PMGY_CANAL Phosphoglycerate mutase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=GPM1 PE=1 SV=3
MPKLVLVRHGQSEWNEKNLFTGWVDVRLSETGQKEAKRAGELLKEAGINVDVLHTSKLSR
AIQTANIALDAADQLYVPVKRSWRLNERHYGALQGKDKAQTLEAYGQEKFQIWRRSFDVP
PPKIDPKDEYSQVGDRRYADVDPAVVPLTESLALVIDRLLPYWQDEIAGDLLAGKVVLIA
AHGNSLRALVKHLDNISDEDIAGLNIPTGIPLVYELDENLKPTKPSYYLDPEAAAAGAAA
VAAQGQKK" |
| Structure Information |
| PDB ID | NA |
| Quaternary structure | NA |
| SCOP | |
| CATH | |
| TM Helix Prediction | no TM helices |
| DisProt Annotation | |
| Predicted Disorder Regions | |
| Connections to Disease |
| OMIM ID | |
| Function 1 |
| Function description | enzyme, catalyzes 3-phosphoglycerate (3-PG) into 2-phosphoglycerate (2-PG) |
| References for function | _ |
| E.C. number | EC:5.4.2.11 |
| Location of functional site(s) | |
| Cellular location of function | cytoplasm |
| Comments | |
| Function 2 |
| Function description | adhesin, binds to heparin sulfate |
| References for function | Ordiales H, Olano C, Martín C, Blanco-Agudín N, Alcalde I, Merayo-Lloves J, Quirós LM. Phosphoglycerate mutase and methionine synthase act as adhesins of Candida albicans to the corneal epithelium, altering their expression during the tissue adhesion process. Exp Eye Res. 2025 May;254:110322. doi: 10.1016/j.exer.2025.110322. Epub 2025 Mar 6. PMID: 40057112. |
| E.C. number | |
| Location of functional site(s) | |
| Cellular location of function | cell surface |
| Comments | |