| General Information |
| MoonProt ID | 4047 |
| First appeared in release | 4.0 |
| Name(s) | diaminopimelate epimerase DapF |
| UniProt ID | B0BC67 |
| GO terms | GO:0008837 diaminopimelate epimerase activity , GO:0016853 isomerase activity , GO:0008652 amino acid biosynthetic process , GO:0009085 lysine biosynthetic process , GO:0009089 lysine biosynthetic process via diaminopimelate , GO:0005737 cytoplasm , GO:0005829 cytosol |
| Organisms for which functions have been demonstrated | Chlamydia trachomatis serovar L2b (strain UCH-1/proctitis) |
| Sequence length | 275.0 |
| FASTA sequence | ">sp|B0BC67|DAPF_CHLTB Diaminopimelate epimerase OS=Chlamydia trachomatis serovar L2b (strain UCH-1/proctitis) OX=471473 GN=dapF PE=3 SV=1
MGFSSLLTTCRYLLYSGAGNSFILGESMPSLEDVLFLCQEEMVDGFLCVESSEIADAKLT
VFNSDGSIASMCGNGLRCAMAHVAQCFGLEDVSIETERGVYQGKFFSMNRVLVDMTLPDW
KKAERKLTHVLPGMPEQVFFIDTGVPHVVVFVSDLSKVPVQEWGSFLRYHEDFAPEGVNV
DFVQRKKDDLLLVYTYERGCERETLSCGTGMLASALVAADIFSLGQDFSIAVCSRSRNLI
KIFSEKGKVFLEGPVSLLNRSENFGWLEPKSRRFG" |
| Structure Information |
| PDB ID | NA |
| Quaternary structure | NA |
| SCOP | |
| CATH | |
| TM Helix Prediction | no TM helices |
| DisProt Annotation | |
| Predicted Disorder Regions | |
| Connections to Disease |
| OMIM ID | |
| Function 1 |
| Function description | enzyme, diaminopimelate epimerase |
| References for function | Liechti G, Singh R, Rossi PL, Gray MD, Adams NE, Maurelli AT. Chlamydia trachomatis dapF Encodes a Bifunctional Enzyme Capable of Both d-Glutamate Racemase and Diaminopimelate Epimerase Activities. mBio. 2018 Apr 3;9(2):e00204-18. doi: 10.1128/mBio.00204-18. PMID: 29615498; PMCID: PMC5885031. |
| E.C. number | 5.1.1.7 |
| Location of functional site(s) | |
| Cellular location of function | cytoplasm |
| Comments | |
| Function 2 |
| Function description | enzyme, glutamate racemase |
| References for function | Liechti G, Singh R, Rossi PL, Gray MD, Adams NE, Maurelli AT. Chlamydia trachomatis dapF Encodes a Bifunctional Enzyme Capable of Both d-Glutamate Racemase and Diaminopimelate Epimerase Activities. mBio. 2018 Apr 3;9(2):e00204-18. doi: 10.1128/mBio.00204-18. PMID: 29615498; PMCID: PMC5885031. |
| E.C. number | 5.1.1.3 |
| Location of functional site(s) | |
| Cellular location of function | cytoplasm |
| Comments | |