| General Information |
| MoonProt ID | 4049 |
| First appeared in release | 4.0 |
| Name(s) | Lactate dehydrogenase; L-lactate dehydrogenase |
| UniProt ID | B6ZBP6 |
| GO terms | "GO:0003824 catalytic activity
GO:0004459 L-lactate dehydrogenase (NAD+) activity
GO:0016491 oxidoreductase activity
GO:0016616 oxidoreductase activity, acting on the CH-OH group of donors, NAD or NADP as acceptor
GO:0006089 lactate metabolic process
GO:0006096 glycolytic process
GO:0019752 carboxylic acid metabolic process
GO:0005737 cytoplasm" |
| Organisms for which functions have been demonstrated | Lactiplantibacillus plantarum (Lactobacillus plantarum) |
| Sequence length | 309.0 |
| FASTA sequence | ">tr|B6ZBP6|B6ZBP6_LACPN L-lactate dehydrogenase OS=Lactiplantibacillus plantarum OX=1590 GN=ldh PE=3 SV=1
MDKKQRKVVIVGDGSVGSSFAFSLVQNCALDELVIVDLVKTHAEGDVKDLEDVAAFTNATNIHTGEYADARDADIVVITAGVPRKPGESRLDLINRNTKILESIVKPVVASGFNGCFVISSNPVDILTSMTQRLSGFPRHRVIGTGTSLDTARLRVALAQKLNVATTAVDAAVLGEHGDSSIVNFDEIMINAQPLKTVTTVDDQFKAEIEQAVRGKGGQIISQKGATFYGVAVSLMQICRAILNDENAELIVSAALSGQYGVNDLYLGSPAIINRNGLQKVIEAELSDDERARMQHFAAKMLTMMNVAS" |
| Structure Information |
| PDB ID | NA |
| Quaternary structure | NA |
| SCOP | |
| CATH | |
| TM Helix Prediction | no TM helices |
| DisProt Annotation | |
| Predicted Disorder Regions | |
| Connections to Disease |
| OMIM ID | |
| Function 1 |
| Function description | enzyme, lactate dehydrogenase, Fermentation; pyruvate fermentation to lactate; (S)-lactate from pyruvate |
| References for function | _ |
| E.C. number | 1.1.1.27 |
| Location of functional site(s) | |
| Cellular location of function | cytoplasm |
| Comments | |
| Function 2 |
| Function description | Adhesin, binds to fish intestinal cells |
| References for function | Wenqian Liu, Zhen Wang, Shengjia Wang, Minghui Liu, Jian Zhang, Xuepeng Li, Hongye Wang, Jixing Feng, Identification of moonlighting adhesins of highly-adhesive Lactobacillus plantarum PO23 isolated from the intestine of Paralichthys olivaceus, Aquaculture, V 590, 2024, 741044, ISSN 0044-8486, |
| E.C. number | |
| Location of functional site(s) | |
| Cellular location of function | cell surface |
| Comments | |