| General Information |
| MoonProt ID | 4056 |
| First appeared in release | 4.0 |
| Name(s) | Mechanosensitive ion channel MscS domain-containing protein |
| UniProt ID | Q97AV5 |
| GO terms | GO:0016020 membrane, GO:0008381 mechanosensitive monoatomic ion channel activity, GO:0034220 monoatomic ion transmembrane transport, GO:0055085 transmembrane transport |
| Organisms for which functions have been demonstrated | Thermoplasma volcanium |
| Sequence length | 288.0 |
| FASTA sequence | ">tr|Q97AV5|Q97AV5_THEVO Mechanosensitive ion channel MscS domain-containing protein OS=Thermoplasma volcanium (strain ATCC 51530 / DSM 4299 / JCM 9571 / NBRC 15438 / GSS1) OX=273116 GN=TVG0710526 PE=4 SV=1
MKQRALREAVAAIAIILVISIALFIIKPAVDYFVFKYLNFLHPYIEYINGGIAAIFVGGG
GILILRIIRRSISQYFLGKSNRSLQNLIELLISFFMYTLIIAVILTSLGINLTGALVGGS
VGALIIGIALQNIFSNIFSGFAVTSAGAIKPGEIVSMGSWLFGSPITGEIVKVSYLFTDV
KNSNGRIIKVPNSAFLGNTIFERLSGESDFSYNVQVTLPSDVPQSAIEKHIREINASQDI
SWFLSGLNGTTMTFNVTINVEDIKDLNGKINDVNKMFNEAYWRAKKEA" |
| Structure Information |
| PDB ID | NA |
| Quaternary structure | NA |
| SCOP | |
| CATH | |
| TM Helix Prediction | 4 |
| DisProt Annotation | |
| Predicted Disorder Regions | |
| Connections to Disease |
| OMIM ID | |
| Function 1 |
| Function description | mechanosensitive channel |
| References for function | _ |
| E.C. number | |
| Location of functional site(s) | |
| Cellular location of function | cell membrane |
| Comments | |
| Function 2 |
| Function description | copper channel |
| References for function | Ghnamah Y, Palmer CD, Livnat-Levanon N, Grupper M, Rosenzweig AC, Lewinson O. Prokaryotic mechanosensitive channels mediate copper influx. Protein Sci. 2025 Jul;34(7):e70205. doi: 10.1002/pro.70205. PMID: 40563205; PMCID: PMC12198049. |
| E.C. number | |
| Location of functional site(s) | |
| Cellular location of function | cell membrane |
| Comments | |