| General Information |
| MoonProt ID | 4059 |
| First appeared in release | 4.0 |
| Name(s) | Vacuolar protein sorting-associated protein 72 homolog - YL-1 |
| UniProt ID | Q9VKM6 |
| GO terms | GO:0000812 Swr1 complex, GO:0003677 DNA binding, GO:0005634 nucleus, GO:0006325 chromatin organization, GO:0006338 chromatin remodeling, GO:0010629 negative regulation of gene expression, GO:0035267 NuA4 histone acetyltransferase complex, GO:0045893 positive regulation of DNA-templated transcription, GO:0140713 histone chaperone activity, GO:0140861 DNA repair-dependent chromatin remodeling |
| Organisms for which functions have been demonstrated | Drosophila melanogaster (fruit fly) |
| Sequence length | 351.0 |
| FASTA sequence | ">sp|Q9VKM6|VPS72_DROME Vacuolar protein sorting-associated protein 72 homolog OS=Drosophila melanogaster OX=7227 GN=YL-1 PE=1 SV=1
MAASRSRRNNAGNKIAHLLNEEEEDDFYKTSYGGFQEDEEDKEYEQKDEEEDVVDSDFSI
DENDEPVSDQEEAPEKKRKRGVVNTKAYKETKPAVKKETKATPALHKKRPGGGVTKRRPR
PRFTVLDSGRKSIRTSTAIKTQATKIRLKELDDARKRKKKKVRVEDYMPTQEELLEEAKI
TEEENTKSLEKFQKMELEKKKSRPTKRTFSGPTIRYHSLTMPAMRKPTRGANPAVDSKDL
AGKCERTFVTIENDFNDKVFQSLFRHKAPPKASNGICPITRLPARYFDPITQQPYYSIQA
FKILREAYYMQLEQQGGGSEQPELAKWLEWRKLVKENRLKASAAASKNGDN" |
| Structure Information |
| PDB ID | 5CHL |
| Quaternary structure | part of multiprotein complex |
| SCOP | "80475545CHL A:4-71
80931485CHL A:4-71" |
| CATH | 5chlB00 |
| TM Helix Prediction | no TM helices |
| DisProt Annotation | |
| Predicted Disorder Regions | |
| Connections to Disease |
| OMIM ID | 600607 - labelled as VPS72 in OMIM |
| Function 1 |
| Function description | component of DOM/TIP60 chromatin remodeling complex |
| References for function | _ |
| E.C. number | |
| Location of functional site(s) | |
| Cellular location of function | nucleus |
| Comments | |
| Function 2 |
| Function description | localizes to the centrosome of the meiotic aparatus during meiosis |
| References for function | Prozzillo, Y., Fattorini, G., Ferreri, D., Leo, M., Dimitri, P., & Messina, G. (2023). Knockdown of DOM/Tip60 Complex Subunits Impairs Male Meiosis of Drosophila melanogaster. Cells, 12(10), 1348. https://doi.org/10.3390/cells12101348 |
| E.C. number | |
| Location of functional site(s) | |
| Cellular location of function | localizes to the centrosome of the meiotic aparatus during meiosis |
| Comments | |