| General Information |
| MoonProt ID | 4064 |
| First appeared in release | 4.0 |
| Name(s) | Alpha-enolase - ENO1 |
| UniProt ID | P06733 |
| GO terms | GO:0000015 phosphopyruvate hydratase complex, GO:0000122 negative regulation of transcription by RNA polymerase II, GO:0000287 magnesium ion binding, GO:0000977 RNA polymerase II transcription regulatory region sequence-specific DNA binding, GO:0001222 transcription corepressor binding, GO:0001227 DNA-binding transcription repressor activity RNA polymerase II-specific, GO:0003677 DNA binding, GO:0003714 transcription corepressor activity, GO:0003723 RNA binding, GO:0004365 glyceraldehyde-3-phosphate dehydrogenase (NAD+) (phosphorylating) activity, GO:0004634 phosphopyruvate hydratase activity, GO:0005515 protein binding, GO:0016020 membrane, GO:0016491 oxidoreductase activity, GO:0016620 oxidoreductase activity acting on the aldehyde or oxo group of donors NAD or NADP as acceptor, GO:0016829 lyase activity, GO:0030308 negative regulation of cell growth, GO:0042803 protein homodimerization activity, GO:0045296 cadherin binding, GO:0045892 negative regulation of DNA-templated transcription, GO:0045933 positive regulation of muscle contraction, GO:0046872 metal ion binding, GO:0050661 NADP binding, GO:0051020 GTPase binding, GO:0051287 NAD binding, GO:0061621 canonical glycolysis, GO:0070062 extracellular exosome, GO:0005634 nucleus, GO:0005737 cytoplasm, GO:0005829 cytosol, GO:0005886 plasma membrane, GO:0005938 cell cortex, GO:0009986 cell surface, GO:0005615 extracellular space, GO:0006094 gluconeogenesis, |
| Organisms for which functions have been demonstrated | Homo sapiens |
| Sequence length | 434.0 |
| FASTA sequence | ">sp|P06733|ENOA_HUMAN Alpha-enolase OS=Homo sapiens OX=9606 GN=ENO1 PE=1 SV=2
MSILKIHAREIFDSRGNPTVEVDLFTSKGLFRAAVPSGASTGIYEALELRDNDKTRYMGK
GVSKAVEHINKTIAPALVSKKLNVTEQEKIDKLMIEMDGTENKSKFGANAILGVSLAVCK
AGAVEKGVPLYRHIADLAGNSEVILPVPAFNVINGGSHAGNKLAMQEFMILPVGAANFRE
AMRIGAEVYHNLKNVIKEKYGKDATNVGDEGGFAPNILENKEGLELLKTAIGKAGYTDKV
VIGMDVAASEFFRSGKYDLDFKSPDDPSRYISPDQLADLYKSFIKDYPVVSIEDPFDQDD
WGAWQKFTASAGIQVVGDDLTVTNPKRIAKAVNEKSCNCLLLKVNQIGSVTESLQACKLA
QANGWGVMVSHRSGETEDTFIADLVVGLCTGQIKTGAPCRSERLAKYNQLLRIEEELGSK
AKFAGRNFRNPLAK" |
| Structure Information |
| PDB ID | 2PSN 3B97 5JLZ 5LAX 5NI9 5NIG 5OCK 8TRL |
| Quaternary structure | NA |
| SCOP | "No SCOP2 classification is available for 5JLZ A explicitly. This entry is represented by following domains ...
80280761KLU A
80404551KLU A
80546701KLU A
80546711KLU A
No SCOP2 classification is available for 5JLZ B explicitly. This entry is represented by following domains ...
80223571A6A B
80347371A6A B
80547021BX2 B
80547031BX2 B
80547041A6A B
80547051A6A B
80556351BX2 B
80556361BX2 B
No SCOP2 classification is available for 5JLZ C explicitly. This entry is represented by following domains ...
80280761KLU A
80404551KLU A
80546701KLU A
80546711KLU A
No SCOP2 classification is available for 5JLZ D explicitly. This entry is represented by following domains ...
80223571A6A B
80347371A6A B
80547021BX2 B
80547031BX2 B
80547041A6A B
80547051A6A B
80556351BX2 B
80556361BX2 B" |
| CATH | 2psnA01, 2psnA02, 2psnB01, 2psnB02, 2psnC01, 2psnC02, 2psnD01, 2psnD02 |
| TM Helix Prediction | no TM helices |
| DisProt Annotation | |
| Predicted Disorder Regions | |
| Connections to Disease |
| OMIM ID | |
| Function 1 |
| Function description | enzyme, enolase, 2-phospho-D-glycerate => phosphoenolpyruvate + H2O Catalyzes the reversible conversion of 2-phosphoglycerate into phosphoenolpyruvate. Carbohydrate degradation, glycolysis |
| References for function | _ |
| E.C. number | EC:4.2.1.11 |
| Location of functional site(s) | |
| Cellular location of function | cytoplasm |
| Comments | |
| Function 2 |
| Function description | tRK1 import into mitochondria |
| References for function | Baleva, M., Gowher, A., Kamenski, P., Tarassov, I., Entelis, N., & Masquida, B. (2015). A Moonlighting Human Protein Is Involved in Mitochondrial Import of tRNA. International journal of molecular sciences, 16(5), 9354–9367. https://doi.org/10.3390/ijms16059354 |
| E.C. number | |
| Location of functional site(s) | |
| Cellular location of function | cytosol to mitochondria |
| Comments | |