| General Information |
| MoonProt ID | 407 |
| First appeared in release | 3.0 |
| Name(s) | mouse peroxiredoxin 2 (Prx2); Thiol-specific antioxidant protein; TSA; Thioredoxin peroxidase 1;
Thioredoxin-dependent peroxide reductase 1 |
| UniProt ID | Q61171 |
| GO terms | GO:0004601 peroxidase activity
GO:0055114 oxidation-reduction process
GO:0016209 antioxidant activity
GO:0016491 oxidoreductase activity
GO:0005737 cytoplasm |
| Organisms for which functions have been demonstrated | Mus musculus (Mouse, mammal) |
| Sequence length | 146 amino acids |
| FASTA sequence | >sp|Q61171|PRDX2_MOUSE Peroxiredoxin-2 OS=Mus musculus OX=10090 GN=Prdx2 PE=1 SV=3
MASGNAQIGKSAPDFTATAVVDGAFKEIKLSDYRGKYVVLFFYPLDFTFVCPTEIIAFSDHAEDFRKLGCEVLGVSVDSQFTHLAWINTPRKEGGLGPLNIPLLADVTKSLSQNYGVLKNDEGIAYRGLFIIDAKGVLRQITVNDLPVGRSVDEALRLVQAFQYTDEHGEVCPAGWKPGSDTIKPNVDDSKEYFSKHN |
| Structure Information |
| PDB ID | NA |
| Quaternary structure | NA |
| SCOP | NA |
| CATH | NA |
| TM Helix Prediction | no TM helices |
| DisProt Annotation | Not in DisProt |
| Predicted Disorder Regions | Predicted disorder at N terminus (aa 1-7), middle region (aa 178-179), and C terminus (aa 185-198) |
| Connections to Disease |
| OMIM ID | |
| Function 1 |
| Function description | Peroxiredoxin |
| References for function | 18708590 |
| E.C. number | |
| Location of functional site(s) | NA |
| Cellular location of function | cytoplasm |
| Comments | NA |
| Function 2 |
| Function description | regulate proinflammatory responses, vascular remodeling, and global oxidative stress |
| References for function | 21835911 |
| E.C. number | 1.11.1.15 |
| Location of functional site(s) | NA |
| Cellular location of function | cytoplasm |
| Comments | NA |