| General Information |
| MoonProt ID | 407 |
| First appeared in release | 3.0 |
| Name(s) | mouse peroxiredoxin 2 (Prx2); Thiol-specific antioxidant protein; TSA; Thioredoxin peroxidase 1;
Thioredoxin-dependent peroxide reductase 1 |
| UniProt ID | Q61171 |
| GO terms | GO:0004601 peroxidase activity
GO:0055114 oxidation-reduction process
GO:0016209 antioxidant activity
GO:0016491 oxidoreductase activity
GO:0005737 cytoplasm |
| Organisms for which functions have been demonstrated | Mus musculus (Mouse, mammal) |
| Sequence length | 146 amino acids |
| FASTA sequence | >sp|Q61171|PRDX2_MOUSE Peroxiredoxin-2 OS=Mus musculus OX=10090 GN=Prdx2 PE=1 SV=3
MASGNAQIGKSAPDFTATAVVDGAFKEIKLSDYRGKYVVLFFYPLDFTFVCPTEIIAFSDHAEDFRKLGCEVLGVSVDSQFTHLAWINTPRKEGGLGPLNIPLLADVTKSLSQNYGVLKNDEGIAYRGLFIIDAKGVLRQITVNDLPVGRSVDEALRLVQAFQYTDEHGEVCPAGWKPGSDTIKPNVDDSKEYFSKHN |
| Structure Information |
| PDB ID | NA |
| Quaternary structure | NA |
| SCOP | NA |
| CATH | NA |
| TM Helix Prediction | no TM helices |
| DisProt Annotation | Not in DisProt |
| Predicted Disorder Regions | Use FASTA sequence on the MFDp2 webserver.
moonID_407_uniID_Q61171 is 198 residues long, with 28 residues (14.14%) predicted as disordered.The protein has 2 short (< 30 residues) disorder segments and 0 long (>= 30 residues) disorder segments.
Segment 1 - Short (< 30 residues) disordered segment Segment is located between positions 1 and 5 in the sequence. The segment is 5 residues long (2.53 % of the total sequence length).
Segment 2 - Short (< 30 residues) disordered segment Segment is located between positions 176 and 198 in the sequence. The segment is 23 residues long (11.62 % of the total sequence length). |
| Connections to Disease |
| OMIM ID | |
| Function 1 |
| Function description | Peroxiredoxin |
| References for function | 18708590 |
| E.C. number | NA |
| Location of functional site(s) | NA |
| Cellular location of function | cytoplasm |
| Comments | NA |
| Function 2 |
| Function description | regulate proinflammatory responses, vascular remodeling, and global oxidative stress |
| References for function | 21835911 |
| E.C. number | 1.11.1.15 |
| Location of functional site(s) | NA |
| Cellular location of function | cytoplasm |
| Comments | NA |