| General Information |
| MoonProt ID | 4083 |
| First appeared in release | 4.0 |
| Name(s) | 3-ketoacyl-ACP reductase |
| UniProt ID | A0A0Z8UQY0 |
| GO terms | "GO:0004316 3-oxoacyl-[acyl-carrier-protein] reductase (NADPH) activity
GO:0016491 oxidoreductase activity
GO:0051287 NAD binding
GO:0006629 lipid metabolic process
GO:0006631 fatty acid metabolic process
GO:0006633 fatty acid biosynthetic process
GO:0032787 monocarboxylic acid metabolic process" |
| Organisms for which functions have been demonstrated | Streptococcus suis serotype 2 |
| Sequence length | 244.0 |
| FASTA sequence | ">tr|A0A0Z8UQY0|A0A0Z8UQY0_STRSU 3-oxoacyl-[acyl-carrier-protein] reductase OS=Streptococcus suis OX=1307 GN=fabG_1 PE=3 SV=1
MELTNKNVFVTGSSRGIGLAIAHKFASLGANVVLNGRGQLGQDILDSFADYDVKVLAISG
DISSAEDAKRMVAEAIETLGSVDILVNNAGITKDGMALRMTEEDFDTVLKVNLTGTFNMT
QAVLKPMTKAREGAIINLSSVSGLIGNAGQANYAASKAGVIGFTKAIAREVAGRNVRVNA
IAPGFIQSDMTDVLSDKIKEAMTAQIPMKRFGATEEVADVAVFLAKQEYLTGQVIAVDGG
LTMQ" |
| Structure Information |
| PDB ID | NA |
| Quaternary structure | homotetramer |
| SCOP | |
| CATH | |
| TM Helix Prediction | no TM helices |
| DisProt Annotation | |
| Predicted Disorder Regions | |
| Connections to Disease |
| OMIM ID | |
| Function 1 |
| Function description | "enzyme, 3-ketoacyl-ACP reductase, Catalyzes the NADPH-dependent reduction of beta-ketoacyl-ACP substrates to beta-hydroxyacyl-ACP products, the first reductive step in the elongation cycle of fatty acid biosynthesis, a (3R)-hydroxyacyl-[ACP] + NADP+ = a 3-oxoacyl-[ACP] + NADPH + H+
a (3R)-hydroxyacyl-[ACP] + NADP+ = a 3-oxoacyl-[ACP] + NADPH + H+
a (3R)-hydroxyacyl-[ACP] + NADP+ = a 3-oxoacyl-[ACP] + NADPH + H+""" |
| References for function | _ |
| E.C. number | EC:1.1.1.100 |
| Location of functional site(s) | |
| Cellular location of function | Cytoplasmic |
| Comments | |
| Function 2 |
| Function description | binds host fibronectin |
| References for function | Zhang H, Zheng J, Yi L, Li Y, Ma Z, Fan H, Lu C. The identification of six novel proteins with fibronectin or collagen type I binding activity from Streptococcus suis serotype 2. J Microbiol. 2014 Nov;52(11):963-9. doi: 10.1007/s12275-014-4311-x. Epub 2014 Oct 31. PMID: 25359271. |
| E.C. number | |
| Location of functional site(s) | |
| Cellular location of function | cell surface |
| Comments | |