| General Information |
| MoonProt ID | 4089 |
| First appeared in release | 4.0 |
| Name(s) | Elongation factor Tu |
| UniProt ID | B3WE38 |
| GO terms | "GO:0000166 nucleotide binding
GO:0000287 magnesium ion binding
GO:0003746 translation elongation factor activity
GO:0003924 GTPase activity
GO:0005525 GTP binding
GO:0016787 hydrolase activity
GO:0046872 metal ion binding
GO:0006412 translation
GO:0006414 translational elongation
GO:0005737 cytoplasm
GO:0005829 cytosol" |
| Organisms for which functions have been demonstrated | Lacticaseibacillus casei (strain BL23) (Lactobacillus casei) |
| Sequence length | 396.0 |
| FASTA sequence | ">sp|B3WE38|EFTU_LACCB Elongation factor Tu OS=Lacticaseibacillus casei (strain BL23) OX=543734 GN=tuf PE=3 SV=1
MAEKEHYERTKPHVNIGTIGHVDHGKTTLTAAITKVLSEKGLAKAQDYASIDAAPEEKER
GITINTAHVEYETEKRHYAHIDAPGHADYVKNMITGAAQMDGAILVVAATDGPMPQTREH
ILLARQVGVDYIVVFLNKTDLVDDPELIDLVEMEVRELLSEYDYPGDDIPVIRGSALKAL
EGDPEQEKVIMELMDTIDEYIPTPVRETDKPFLMPVEDVFTITGRGTVASGRIDRGTVKI
GDEVEIIGLKPDVIKSTVTGLEMFRKTLDLGEAGDNVGVLLRGVNREQVERGQVLAKPGS
IQLHNKFKGEVYILTKEEGGRHTPFFSNYRPQFYFHTTDVTGVIELPDGVEMVMPGDNVT
FEVDLIAPVAIEKGTKFTVREGGRTVGAGVVSEILD" |
| Structure Information |
| PDB ID | NA |
| Quaternary structure | monomer |
| SCOP | |
| CATH | |
| TM Helix Prediction | no TM helices |
| DisProt Annotation | |
| Predicted Disorder Regions | |
| Connections to Disease |
| OMIM ID | |
| Function 1 |
| Function description | peptide elongation factor during protein synthesis at the ribosome |
| References for function | _ |
| E.C. number | |
| Location of functional site(s) | |
| Cellular location of function | cytoplasm, interacting with the ribosome |
| Comments | |
| Function 2 |
| Function description | binds fibronectin, binds collagen |
| References for function | Munoz-Provencio D, Monedero V. Shotgun phage display of Lactobacillus casei BL23 against collagen and fibronectin. J Microbiol Biotechnol. 2011 Feb;21(2):197-203. doi: 10.4014/jmb.1009.09011. PMID: 21364304. |
| E.C. number | |
| Location of functional site(s) | |
| Cellular location of function | cell surface |
| Comments | |