| General Information |
| MoonProt ID | 4092 |
| First appeared in release | 4.0 |
| Name(s) | Glyceraldehyde-3-phosphate dehydrogenase |
| UniProt ID | A0A5R8LPX3 |
| GO terms | "GO:0000166 nucleotide binding
GO:0016491 oxidoreductase activity
GO:0016620 oxidoreductase activity, acting on the aldehyde or oxo group of donors, NAD or NADP as acceptor
GO:0050661 NADP binding
GO:0051287 NAD binding
GO:0006006 glucose metabolic process" |
| Organisms for which functions have been demonstrated | Lacticaseibacillus zeae (Lactobacillus zeae) |
| Sequence length | 340.0 |
| FASTA sequence | ">tr|A0A5R8LPX3|A0A5R8LPX3_LACZE Glyceraldehyde-3-phosphate dehydrogenase OS=Lacticaseibacillus zeae OX=57037 GN=gap PE=3 SV=1
MTVKIGINGFGRIGRLAFRRIYELGAKSNDIQVVAINDLTSPTMLAHLLKYDSTHGTFPG
EVSATDNGIVVDGKEYRVYAEPQAQNIPWVKNDGVDYVLECTGFYTSAEKSQAHLDAGAK
RVLISAPAGKMKTIVYNVNDDTLNADDKIVSAGSCTTNCLAPMAYFLNKEFGIEVGTMTT
VHAYTSTQMLLDGPVRGGNLRAARSAAANTIPHSTGAAKAIGLVIPELNGKLQGHAQRVS
VVDGSLTELVSILKTKNVTADQVNEAIKKHTENNPSFGWNEDEIVSSDVIGTTYGSIFDP
TQTEVTTAGDYQLVKTVAWYDNEYGFTCQMIRTLLKFATL" |
| Structure Information |
| PDB ID | NA |
| Quaternary structure | NA |
| SCOP | |
| CATH | |
| TM Helix Prediction | no TM helices |
| DisProt Annotation | |
| Predicted Disorder Regions | |
| Connections to Disease |
| OMIM ID | |
| Function 1 |
| Function description | enzyme, glyceraldehyde 3-phosphate dehydrogenase, catalyzes the reversible oxidative phosphorylation of glyceraldehyde 3-phosphate to 1,3-bisphosphate coupled with reduction of NAD+ to NADH |
| References for function | _ |
| E.C. number | |
| Location of functional site(s) | |
| Cellular location of function | cytoplasm |
| Comments | |
| Function 2 |
| Function description | binds fibronectin, binds collagen |
| References for function | Munoz-Provencio D, Monedero V. Shotgun phage display of Lactobacillus casei BL23 against collagen and fibronectin. J Microbiol Biotechnol. 2011 Feb;21(2):197-203. doi: 10.4014/jmb.1009.09011. PMID: 21364304. |
| E.C. number | |
| Location of functional site(s) | |
| Cellular location of function | cell surface |
| Comments | |