| General Information |
| MoonProt ID | 4097 |
| First appeared in release | 4.0 |
| Name(s) | Small-conductance mechanosensitive channel |
| UniProt ID | A0A712CR23 |
| GO terms | "GO:0008381 mechanosensitive monoatomic ion channel activity
GO:0006811 monoatomic ion transport
GO:0034220 monoatomic ion transmembrane transport
GO:0055085 transmembrane transport
GO:0005886 plasma membrane
GO:0016020 membrane" |
| Organisms for which functions have been demonstrated | Salmonella enterica I |
| Sequence length | 253.0 |
| FASTA sequence | ">tr|A0A712CR23|A0A712CR23_SALET Small-conductance mechanosensitive channel (Fragment) OS=Salmonella enterica I OX=59201 GN=G1H61_15580 PE=3 SV=1
MEGFELFPKIKGAIKWMAEHSDSVIHFGWNVVAAIILLFIGKLIARLLSRGLEKLLLRRQ
VDATIVHFFSALVRYITIAFTAVAALGRVGIETSSIIAVIGAAGLAIGLALQGALSNFAA
GVLLVSLRPFRAGEIVQIGLVIGTVEKVHIFSTTLLTADSKEVVIPNGKIIADNIINYSR
HPYRRIDLIIGVDYQSRIADVKSVIHRIIEQDHRIDKTRDITVRLGELAPSSLNFYVRVW
VPNAQYWSTYYDL" |
| Structure Information |
| PDB ID | NA |
| Quaternary structure | homoheptamer |
| SCOP | |
| CATH | |
| TM Helix Prediction | 3 |
| DisProt Annotation | |
| Predicted Disorder Regions | |
| Connections to Disease |
| OMIM ID | |
| Function 1 |
| Function description | mechanosensitive channel |
| References for function | _ |
| E.C. number | |
| Location of functional site(s) | |
| Cellular location of function | membrane |
| Comments | |
| Function 2 |
| Function description | copper channel |
| References for function | Ghnamah Y, Palmer CD, Livnat-Levanon N, Grupper M, Rosenzweig AC, Lewinson O. Prokaryotic mechanosensitive channels mediate copper influx. Protein Sci. 2025 Jul;34(7):e70205. doi: 10.1002/pro.70205. PMID: 40563205; PMCID: PMC12198049. |
| E.C. number | |
| Location of functional site(s) | |
| Cellular location of function | membrane |
| Comments | |