| General Information |
| MoonProt ID | 4099 |
| First appeared in release | 4.0 |
| Name(s) | 2,3-bisphosphoglycerate-independent phosphoglycerate mutase |
| UniProt ID | P75167 |
| GO terms | "GO:0003824 catalytic activity
GO:0004619 phosphoglycerate mutase activity
GO:0005515 protein binding
GO:0005515 protein binding
GO:0005515 protein binding
GO:0016853 isomerase activity
GO:0030145 manganese ion binding
GO:0046872 metal ion binding
GO:0005975 carbohydrate metabolic process
GO:0006007 glucose catabolic process
GO:0006096 glycolytic process
GO:0051919 positive regulation of fibrinolysis
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0016020 membrane" |
| Organisms for which functions have been demonstrated | Mycoplasma pneumoniae (strain ATCC 29342 / M129 / Subtype 1) (Mycoplasmoides pneumoniae) |
| Sequence length | 508.0 |
| FASTA sequence | ">sp|P75167|GPMI_MYCPN 2,3-bisphosphoglycerate-independent phosphoglycerate mutase OS=Mycoplasma pneumoniae (strain ATCC 29342 / M129 / Subtype 1) OX=272634 GN=gpmI PE=1 SV=1
MHKKVLLAILDGYGISNKQHGNAVYHAKTPALDSLIKDYPCVMLEASGEAVGLPQGQIGN
SEVGHLNIGAGRIVYTGLSLINQNIKTGAFHHNQVLLEAIARAKANNAKLHLIGLFSHGG
VHSHMDHLYALIKLAAPQVKMVLHLFGDGRDVAPCTMKSDLEAFMVFLKDYHNVIIGTLG
GRYYGMDRDQRWDREEIAYNAILGNSKASFTDPVAYVQSAYDQKVTDEFLYPAVNGNVDK
EQFALKDHDSVIFFNFRPDRARQMSHMLFQTDYYDYTPKAGRKYNLFFVTMMNYEGIKPS
AVVFPPETIPNTFGEVIAHNKLKQLRIAETEKYAHVTFFFDGGVEVDLPNETKCMVPSLK
VATYDLAPEMACKGITDQLLNQINQFDLTVLNFANPDMVGHTGNYAACVQGLEALDVQIQ
RIIDFCKANHITLFLTADHGNAEEMIDSNNNPVTKHTVNKVPFVCTDTNIDLQQDSASLA
NIAPTILAYLGLKQPAEMTANSLLISKK" |
| Structure Information |
| PDB ID | NA |
| Quaternary structure | NA |
| SCOP | |
| CATH | |
| TM Helix Prediction | 0 |
| DisProt Annotation | |
| Predicted Disorder Regions | |
| Connections to Disease |
| OMIM ID | |
| Function 1 |
| Function description | enzyme, phosphoglycerate mutase, in cytoplasm, glycolysis, muscle isoform, EC 5.4.2.1, conversion of 3-phosphoglycerate (3-PG) to 2-phosphoglycerate (2-PG) |
| References for function | _ |
| E.C. number | |
| Location of functional site(s) | |
| Cellular location of function | cytoplasm |
| Comments | |
| Function 2 |
| Function description | adhesin, binds host ECM, binds laminin, vitronectin, fibrinogen, |
| References for function | Gründel A, Jacobs E, Dumke R. Interactions of surface-displayed glycolytic enzymes of Mycoplasma pneumoniae with components of the human extracellular matrix. Int J Med Microbiol. 2016 Dec;306(8):675-685. doi: 10.1016/j.ijmm.2016.09.001. Epub 2016 Sep 3. PMID: 27616280. |
| E.C. number | |
| Location of functional site(s) | |
| Cellular location of function | cell surface |
| Comments | |