| General Information |
| MoonProt ID | 4106 |
| First appeared in release | 4.0 |
| Name(s) | 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase |
| UniProt ID | A4W369 |
| GO terms | "GO:0004619 phosphoglycerate mutase activity
GO:0016853 isomerase activity
GO:0016868 intramolecular phosphotransferase activity
GO:0006094 gluconeogenesis
GO:0006096 glycolytic process" |
| Organisms for which functions have been demonstrated | "GO:0004619 phosphoglycerate mutase activity
GO:0016853 isomerase activity
GO:0016868 intramolecular phosphotransferase activity
GO:0006094 gluconeogenesis
GO:0006096 glycolytic process" |
| Sequence length | 230.0 |
| FASTA sequence | ">sp|A4W369|GPMA_STRS2 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Streptococcus suis (strain 98HAH33) OX=391296 GN=gpmA PE=3 SV=1
MVKLVFARHGESEWNKANLFTGWADVDLSEKGTQQAIDAGKLIKEAGIEFDLAFTSVLKRAIKTTNLALEAADQLWVPVEKSWRLNERHYGGLTGLNKAEAAAEFGDEQVHIWRRSYDTLPPEMAKDHEHSAHTDRRYAHLDDSVIPDAENLKVTLERALPFWEDKIAPALKDGKNVFVGAHGNSIRALVKHIKQLSDDEIMDVEIPNFPPLVFELDENLNIVKEYYLEA" |
| Structure Information |
| PDB ID | NA |
| Quaternary structure | NA |
| SCOP | |
| CATH | |
| TM Helix Prediction | 0 |
| DisProt Annotation | |
| Predicted Disorder Regions | |
| Connections to Disease |
| OMIM ID | |
| Function 1 |
| Function description | enzyme, Phosphoglycerate mutase, converts 1,3-bisphosphoglycerate <=> 2,3-bisphosphoglycerate |
| References for function | _ |
| E.C. number | 5.4.2.11 |
| Location of functional site(s) | |
| Cellular location of function | Cytoplasm |
| Comments | |
| Function 2 |
| Function description | binds host collagene type I and fibronectin |
| References for function | Zhang, H., Zheng, J., Yi, L. et al. The identification of six novel proteins with fibronectin or collagen type I binding activity from Streptococcus suis serotype 2. J Microbiol. 52, 963–969 (2014). https://doi.org/10.1007/s12275-014-4311-x |
| E.C. number | |
| Location of functional site(s) | |
| Cellular location of function | cell surface |
| Comments | |