| General Information |
| MoonProt ID | 4108 |
| First appeared in release | 4.0 |
| Name(s) | X-ray repair cross-complementing protein 5 or Ku80 (XRCC5) |
| UniProt ID | P13010 |
| GO terms | "GO:0006302 double-strand break repair
GO:0008283 cell population proliferation
GO:0050769 positive regulation of neurogenesis
GO:0060218 hematopoietic stem cell differentiation
GO:1990830 cellular response to leukemia inhibitory factor
GO:0003690 double-stranded DNA binding
GO:0003691 double-stranded telomeric DNA binding
GO:0045027 DNA end binding
GO:0051575 5'-deoxyribose-5-phosphate lyase activity
GO:0000166 nucleotide binding
GO:0000976 transcription cis-regulatory region binding
GO:0003677 DNA binding
GO:0003678 DNA helicase activity
GO:0003684 damaged DNA binding
GO:0003690 double-stranded DNA binding
GO:0003723 RNA binding
GO:0004386 helicase activity
GO:0005515 protein binding
GO:0005524 ATP binding
GO:0008047 enzyme activator activity
GO:0008094 ATP-dependent activity, acting on DNA
GO:0016787 hydrolase activity
GO:0016887 ATP hydrolysis activity
GO:0031625 ubiquitin protein ligase binding
GO:0034511 U3 snoRNA binding
GO:0042162 telomeric DNA binding
GO:0044877 protein-containing complex binding
GO:0045027 DNA end binding
GO:0000723 telomere maintenance
GO:0000725 recombinational repair
GO:0002218 activation of innate immune response
GO:0002376 immune system process
GO:0006281 DNA repair
GO:0006302 double-strand break repair
GO:0006303 double-strand break repair via nonhomologous end joining
GO:0006310 DNA recombination
GO:0006974 DNA damage response
GO:0007004 telomere maintenance via telomerase
GO:0032204 regulation of telomere maintenance
GO:0034462 small-subunit processome assembly
GO:0042254 ribosome biogenesis
GO:0045087 innate immune response
GO:0045892 negative regulation of DNA-templated transcription
GO:0048660 regulation of smooth muscle cell proliferation
GO:0070198 protein localization to chromosome, telomeric region
GO:0071480 cellular response to gamma radiation
GO:1904430 negative regulation of t-circle formation
GO:0000781 chromosome, telomeric region
GO:0005576 extracellular region
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005694 chromosome
GO:0005730 nucleolus
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0016020 membrane
GO:0034774 secretory granule lumen
GO:0090734 site of DNA damage
GO:0000783 nuclear telomere cap complex
GO:0005958 DNA-dependent protein kinase-DNA ligase 4 complex
GO:0032040 small-subunit processome
GO:0032991 protein-containing complex
GO:0032993 protein-DNA complex
GO:0043564 Ku70:Ku80 complex
GO:0070418 DNA-dependent protein kinase complex
GO:0070419 nonhomologous end joining complex
GO:1990904 ribonucleoprotein complex" |
| Organisms for which functions have been demonstrated | Homo sapiens (Human) |
| Sequence length | 732 |
| FASTA sequence | ">sp|P13010|XRCC5_HUMAN X-ray repair cross-complementing protein 5 OS=Homo sapiens OX=9606 GN=XRCC5 PE=1 SV=3
MVRSGNKAAVVLCMDVGFTMSNSIPGIESPFEQAKKVITMFVQRQVFAENKDEIALVLFGTDGTDNPLSGGDQYQNITVHRHLMLPDFDLLEDIESKIQPGSQQADFLDALIVSMDVIQHETIGKKFEKRHIEIFTDLSSRFSKSQLDIIIHSLKKCDISLQFFLPFSLGKEDGSGDRGDGPFRLGGHGPSFPLKGITEQQKEGLEIVKMVMISLEGEDGLDEIYSFSESLRKLCVFKKIERHSIHWPCRLTIGSNLSIRIAAYKSILQERVKKTWTVVDAKTLKKEDIQKETVYCLNDDDETEVLKEDIIQGFRYGSDIVPFSKVDEEQMKYKSEGKCFSVLGFCKSSQVQRRFFMGNQVLKVFAARDDEAAAVALSSLIHALDDLDMVAIVRYAYDKRANPQVGVAFPHIKHNYECLVYVQLPFMEDLRQYMFSSLKNSKKYAPTEAQLNAVDALIDSMSLAKKDEKTDTLEDLFPTTKIPNPRFQRLFQCLLHRALHPREPLPPIQQHIWNMLNPPAEVTTKSQIPLSKIKTLFPLIEAKKKDQVTAQEIFQDNHEDGPTAKKLKTEQGGAHFSVSSLAEGSVTSVGSVNPAENFRVLVKQKKASFEEASNQLINHIEQFLDTNETPYFMKSIDCIRAFREEAIKFSEEQRFNNFLKALQEKVEIKQLNHFWEIVVQDGITLITKEEASGSSVTAEEAKKFLAPKDKPSGDTAAVFEEGGDVDDLLDMI" |
| Structure Information |
| PDB ID | 1JEQ, 1JEY, 1Q2Z, 1RW2, 3RZ9, 5Y3R, 6ERF, 6ERG, 6ERH, 6ZH6, 6ZHA, 6ZHE |
| Quaternary structure | heterodimer |
| SCOP | "80231051JEQ A:559-609
80354851JEQ A:559-609" |
| CATH | 1jeqA01, 1jeqA02, 1jeqA03, 1jeqA04, 1jeqA05, 1jeqB01, 1jeqB02, 1jeqB02 |
| TM Helix Prediction | 0 |
| DisProt Annotation | |
| Predicted Disorder Regions | |
| Connections to Disease |
| OMIM ID | |
| Function 1 |
| Function description | binds DNA, initiates the non-homologous end-joining (NHEJ) DNA repair pathway, recurits other NHEJ factors |
| References for function | _ |
| E.C. number | 3.6.4. |
| Location of functional site(s) | |
| Cellular location of function | nucleus |
| Comments | |
| Function 2 |
| Function description | binds double-stranded RNA |
| References for function | Zhu, Y., Li, A., Maji, S. et al. Ku limits RNA-induced innate immunity to allow Alu expansion in primates. Nature 643, 562–571 (2025). https://doi.org/10.1038/s41586-025-09104-w |
| E.C. number | |
| Location of functional site(s) | |
| Cellular location of function | Nucleus/cytoplasm |
| Comments | |