| General Information |
| MoonProt ID | 4114 |
| First appeared in release | 4.0 |
| Name(s) | Fructose-bisphosphate aldolase |
| UniProt ID | A0A0Z8M0B9 |
| GO terms | "GO:0004332 fructose-bisphosphate aldolase activity
GO:0008270 zinc ion binding
GO:0016829 lyase activity
GO:0016832 aldehyde-lyase activity
GO:0046872 metal ion binding
GO:0005975 carbohydrate metabolic process
GO:0006096 glycolytic process
GO:0030388 fructose 1,6-bisphosphate metabolic process" |
| Organisms for which functions have been demonstrated | Streptococcus suis |
| Sequence length | 293.0 |
| FASTA sequence | ">tr|A0A0Z8M0B9|A0A0Z8M0B9_STRSU Fructose-bisphosphate aldolase OS=Streptococcus suis OX=1307 GN=fba PE=3 SV=1
MPLVSAEKFVQAARDNGYAVGGFNTNNLEWTQAILRAAEAKQAPVLIQTSMGAAKYMGGYKVARNLIANLIEAMNITVPVAIHLDHGHYEDALECIEVGYTSIMFDGSHLPVEENLAKAKEVVELAHAKGISVEAEVGTIGGEEDGIIGSGELAPIEDAVAMVATGIDFLAAGIGNIHGPYPANWEGLDLDHLHKLTEAVPGFPIVLHGGSGIPDEQIQAAIKLGVAKVNVNTECQIAFANATRKFAAAYEANEAEYDKKKLFDPRKFLADGVKAIQASVEERIDVFGSANKA" |
| Structure Information |
| PDB ID | NA |
| Quaternary structure | NA |
| SCOP | |
| CATH | |
| TM Helix Prediction | 0 |
| DisProt Annotation | |
| Predicted Disorder Regions | |
| Connections to Disease |
| OMIM ID | |
| Function 1 |
| Function description | enzyme, fructose-bisphosphate aldolase, in glycolysis and gluconeogenesis, D-fructose 1,6-bisphosphate -> dihydroxyacetone phosphate + D-glyceraldehyde 3-phosphate |
| References for function | _ |
| E.C. number | 4.1.2.13 |
| Location of functional site(s) | |
| Cellular location of function | cytoplasm |
| Comments | |
| Function 2 |
| Function description | binds host collagene type I and fibronectin; immunogenic surface protein |
| References for function | Zhang, H., Zheng, J., Yi, L. et al. The identification of six novel proteins with fibronectin or collagen type I binding activity from Streptococcus suis serotype 2. J Microbiol. 52, 963–969 (2014). https://doi.org/10.1007/s12275-014-4311-x |
| E.C. number | |
| Location of functional site(s) | |
| Cellular location of function | Cell surface |
| Comments | |