| General Information |
| MoonProt ID | 418 |
| First appeared in release | 3.0 |
| Name(s) | Glucose-6-phosphate isomerase |
| UniProt ID | P83780 |
| GO terms | GO:0062040 fungal biofilm matrix
GO:0005829 cytosol
GO:0006094 gluconeogenesis
GO:0004347 glucose-6-phosphate isomerase activity
GO:0048029 monosaccharide binding
GO:0051156 glucose 6-phosphate metabolic process
GO:0006096 glycolytic process
GO:0005737 cytoplasm
GO:0016853 isomerase activity |
| Organisms for which functions have been demonstrated | Candida albicans (yeast, a fungi, can cause candiadiasis) |
| Sequence length | 550 amino acids |
| FASTA sequence | >sp|P83780|G6PI_CANAL Glucose-6-phosphate isomerase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=PGI1 PE=1 SV=2
MASFKLATDLPEWKKLEETYKSVGEKFSVRDAFAKDPKRFEEFSWIYKNYDDSKILFDFSKNLVNKEILDQLVTLAKEAGVEKLRDAMFAGDHINTTEDRAVYHVALRNRALRKMPVDGKDTAQEVDDVLKHMKEFSDSIRDGSWTGYTGKSITDVVNIGIGGSDLGPVMVTEAKAYSKPGLNVHFISNIDGTHTAETLKNLNPETTLFLIASKTFTTAETITNATSAKNWFLATAKDSKHIAKHFAALSTNEKEVVAFGIDAKNMFGFESWVGGRYSVWSAIGLSVAIYIGFENFNDFLKGAEAMDQHFLTTPLENNIPVIGGLLSVWYNNFFGAQTHLVVPFDQYLHRFPAYLQQLSMESNGKSVTRANVFTNYQTGTILFGEPATNAQHSFFQLVHQGTKLIPADFILAAQSHNPIEKNLHQRMLASNFFAQSEALMVGKDEAKVKAEGATGGLVPHKEFSGNRPTTSILAQKITPATLGSLIAYYEHLTFTEGAIWNINSFDQWGVELGKVLAKVIGKELDDKKAVATHDASTNGLINQFKEWEE |
| Structure Information |
| PDB ID | 2PUW |
| Quaternary structure | NA |
| SCOP | NA |
| CATH | NA |
| TM Helix Prediction | no TM helices |
| DisProt Annotation | Not in DisProt |
| Predicted Disorder Regions | Use FASTA sequence on the MFDp2 webserver.
moonID_418_uniID_P83780 is 550 residues long, with 11 residues (2.00%) predicted as disordered.The protein has 2 short (< 30 residues) disorder segments and 0 long (>= 30 residues) disorder segments.
Segment 1 - Short (< 30 residues) disordered segment Segment is located between positions 1 and 10 in the sequence. The segment is 10 residues long (1.82 % of the total sequence length).
Segment 2 - Short (< 30 residues) disordered segment Segment is located between positions 550 and 550 in the sequence. The segment is 1 residues long (0.18 % of the total sequence length). |
| Connections to Disease |
| OMIM ID | |
| Function 1 |
| Function description | Glycose-6-phosphate Isomerase |
| References for function | 21873635 |
| E.C. number | 5.3.1.9 |
| Location of functional site(s) | NA |
| Cellular location of function | cytoplasm |
| Comments | NA |
| Function 2 |
| Function description | cell wall-associating protein that is immunoreactive during fungal infection |
| References for function | 15378749 |
| E.C. number | NA |
| Location of functional site(s) | NA |
| Cellular location of function | cell wall |
| Comments | NA |