General Information |
MoonProt ID | 418 |
First appeared in release | 3.0 |
Name(s) | Glucose-6-phosphate isomerase |
UniProt ID | P83780 |
GO terms | GO:0062040 fungal biofilm matrix
GO:0005829 cytosol
GO:0006094 gluconeogenesis
GO:0004347 glucose-6-phosphate isomerase activity
GO:0048029 monosaccharide binding
GO:0051156 glucose 6-phosphate metabolic process
GO:0006096 glycolytic process
GO:0005737 cytoplasm
GO:0016853 isomerase activity |
Organisms for which functions have been demonstrated | Candida albicans (yeast, a fungi, can cause candiadiasis) |
Sequence length | 550 amino acids |
FASTA sequence | >sp|P83780|G6PI_CANAL Glucose-6-phosphate isomerase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=PGI1 PE=1 SV=2
MASFKLATDLPEWKKLEETYKSVGEKFSVRDAFAKDPKRFEEFSWIYKNYDDSKILFDFSKNLVNKEILDQLVTLAKEAGVEKLRDAMFAGDHINTTEDRAVYHVALRNRALRKMPVDGKDTAQEVDDVLKHMKEFSDSIRDGSWTGYTGKSITDVVNIGIGGSDLGPVMVTEAKAYSKPGLNVHFISNIDGTHTAETLKNLNPETTLFLIASKTFTTAETITNATSAKNWFLATAKDSKHIAKHFAALSTNEKEVVAFGIDAKNMFGFESWVGGRYSVWSAIGLSVAIYIGFENFNDFLKGAEAMDQHFLTTPLENNIPVIGGLLSVWYNNFFGAQTHLVVPFDQYLHRFPAYLQQLSMESNGKSVTRANVFTNYQTGTILFGEPATNAQHSFFQLVHQGTKLIPADFILAAQSHNPIEKNLHQRMLASNFFAQSEALMVGKDEAKVKAEGATGGLVPHKEFSGNRPTTSILAQKITPATLGSLIAYYEHLTFTEGAIWNINSFDQWGVELGKVLAKVIGKELDDKKAVATHDASTNGLINQFKEWEE |
Structure Information |
PDB ID | 2PUW |
Quaternary structure | NA |
SCOP | NA |
CATH | NA |
TM Helix Prediction | no TM helices |
DisProt Annotation | Not in DisProt |
Predicted Disorder Regions | Use FASTA sequence on the MFDp2 webserver.
moonID_418_uniID_P83780 is 550 residues long, with 11 residues (2.00%) predicted as disordered.The protein has 2 short (< 30 residues) disorder segments and 0 long (>= 30 residues) disorder segments.
Segment 1 - Short (< 30 residues) disordered segment Segment is located between positions 1 and 10 in the sequence. The segment is 10 residues long (1.82 % of the total sequence length).
Segment 2 - Short (< 30 residues) disordered segment Segment is located between positions 550 and 550 in the sequence. The segment is 1 residues long (0.18 % of the total sequence length). |
Connections to Disease |
OMIM ID | |
Function 1 |
Function description | Glycose-6-phosphate Isomerase |
References for function | 21873635 |
E.C. number | 5.3.1.9 |
Location of functional site(s) | NA |
Cellular location of function | cytoplasm |
Comments | NA |
Function 2 |
Function description | cell wall-associating protein that is immunoreactive during fungal infection |
References for function | 15378749 |
E.C. number | NA |
Location of functional site(s) | NA |
Cellular location of function | cell wall |
Comments | NA |