| General Information |
| MoonProt ID | 422 |
| First appeared in release | 3.0 |
| Name(s) | Peroxiredoxin 6, 1-Cys peroxiredoxin, 1-Cys PRX, Acidic calcium-independent phospholipase A2 , aiPLA2, Antioxidant protein 2, Non-selenium glutathione peroxidase, NSGPx, Thiol-specific antioxidant protein, gene: Prdx 6 |
| UniProt ID | O35244 |
| GO terms | GO:0005829 cytosol
GO:0045454 cell redox homeostasis
GO:0005739 mitochondrion
GO:0005737 cytoplasm
GO:0055114 oxidation-reduction process
GO:0016209 antioxidant activity
GO:0016491 oxidoreductase activity
GO:0051920 peroxiredoxin activity
GO:0016787 hydrolase activity
GO:0008152 metabolic process
GO:0005764 lysosome
GO:0004601 peroxidase activity
GO:0016042 lipid catabolic process
GO:0003824 catalytic activity
GO:0016209 antioxidant activity
GO:0006629 lipid metabolic process
GO:0102567 phospholipase A2 activity (consuming 1,2-dipalmitoylphosphatidylcholine)
GO:0004623 phospholipase A2 activity
GO:0102568 phospholipase A2 activity consuming 1,2-dioleoylphosphatidylethanolamine)
GO:0042744 hydrogen peroxide catabolic process
GO:0004602 glutathione peroxidase activity
GO:0048471 perinuclear region of cytoplasm
GO:0048026 positive regulation of mRNA splicing, via spliceosome
GO:0031625 ubiquitin protein ligase binding
GO:0000302 response to reactive oxygen species
GO:0098869 cellular oxidant detoxification
GO:0046475 glycerophospholipid catabolic process
GO:0042802 identical protein binding
GO:0032060 bleb assembly
GO:0006979 response to oxidative stress
GO:0005634 nucleus
GO:0005515 protein binding
GO:0048471 perinuclear region of cytoplasm
GO:0047499 calcium-independent phospholipase A2 activity
GO:0046475 glycerophospholipid catabolic process
GO:0042802 identical protein binding
GO:0006979 response to oxidative stress
GO:0005764 lysosome
GO:0005737 cytoplasm |
| Organisms for which functions have been demonstrated | Rattus norvegicus (Rat, mammal)) |
| Sequence length | 224 amino acids |
| FASTA sequence | >sp|O35244|PRDX6_RAT Peroxiredoxin-6 OS=Rattus norvegicus OX=10116 GN=Prdx6 PE=1 SV=3
MPGGLLLGDEAPNFEANTTIGHIRFHDFLGDSWGILFSHPRDFTPVCTTELGRAAKLAPEFAKRNVKLIALSIDSVEDHFAWSKDINAYNGAAPTEKLPFPIIDDKDRDLAILLGMLDPAEKDEKGMPVTARVVFIFGPDKKLKLSILYPATTGRNFDEILRVVDSLQLTASNPVATPVDWKKGESVMVLPTLPEEEAKQLFPKGVFTKELPSGKKYLRYTPQP |
| Structure Information |
| PDB ID | 5B6M_A |
| Quaternary structure | NA |
| SCOP | NA |
| CATH | NA |
| TM Helix Prediction | no TM helices |
| DisProt Annotation | Not in DisProt |
| Predicted Disorder Regions | NA |
| Connections to Disease |
| OMIM ID | |
| Function 1 |
| Function description | Peroxiredoxin activity |
| References for function | 17652308 |
| E.C. number | 1.11.1.27 |
| Location of functional site(s) | NA |
| Cellular location of function | Lysosome |
| Comments | Other locations: Cytoplasm peroxidatic cysteine is oxidized to a sulfenic acid by the peroxide substrate |
| Function 2 |
| Function description | Chapterone |
| References for function | 17652308 |
| E.C. number | NA |
| Location of functional site(s) | NA |
| Cellular location of function | Lysosome/Cytoplasm |
| Comments | NA |