| General Information |
| MoonProt ID | 432 |
| First appeared in release | 3.0 |
| Name(s) | Superoxide dismutase 3 |
| UniProt ID | Q96UT6 |
| GO terms | GO:0004784 superoxide dismutase activity
GO:0006801 superoxide metabolic process
GO:0055114 oxidation-reduction process
GO:0046872 metal ion binding
GO:0055114 oxidation-reduction process
GO:0016491 oxidoreductase activity
GO:0019430 removal of superoxide radicals |
| Organisms for which functions have been demonstrated | Candida albicans (yeast, a fungi, can cause candiadiasis) |
| Sequence length | 206 amino acids |
| FASTA sequence | >tr|Q96UT6|Q96UT6_CANAX Superoxide dismutase OS=Candida albicans OX=5476 GN=Sod3 PE=1 SV=1
MITENEKISLPKIDWALDALEPYISKEINDLHINKHHVAYVNGYNAAIDALEKAVGKRDLKSVVEIQQNIKFHGGGHTNHSLFWKNLAPVSKGGGKHPDTSSALGKQIVAQYGSVSNLIDITNSKLAGIQGSGWAFIVKNKQNGGALDVVTTANQDTISAPHLVPIIAIDAWEHAYYLQYQNVKLDYFKAIWNVINWAEAESRYSA |
| Structure Information |
| PDB ID | 4GUN |
| Quaternary structure | NA |
| SCOP | NA |
| CATH | NA |
| TM Helix Prediction | no TM helices |
| DisProt Annotation | Not in DisProt |
| Predicted Disorder Regions | Use FASTA sequence on the MFDp2 webserver.
moonID_432_uniID_Q96UT6 is 206 residues long, with 9 residues (4.37%) predicted as disordered.The protein has 1 short (< 30 residues) disorder segment and 0 long (>= 30 residues) disorder segments.
Segment 1 - Short (< 30 residues) disordered segment Segment is located between positions 1 and 9 in the sequence. The segment is 9 residues long (4.37 % of the total sequence length). |
| Connections to Disease |
| OMIM ID | |
| Function 1 |
| Function description | removes radicals, 2 H+ + 2 superoxide = H2O2 + O2 |
| References for function | 26636139 |
| E.C. number | 1.15.1.1 |
| Location of functional site(s) | NA |
| Cellular location of function | NA |
| Comments | NA |
| Function 2 |
| Function description | binds to 3 plasma proteins: high-molecular-mass kininogen (HK), factor XII (FXII) and prekallikrein (PPK) |
| References for function | 26636139 |
| E.C. number | NA |
| Location of functional site(s) | NA |
| Cellular location of function | cell surface |
| Comments | NA |