| General Information |
| MoonProt ID | 434 |
| First appeared in release | 3.0 |
| Name(s) | ADP/ATP translocase 1, ADP,ATP carrier protein 1
ADP,ATP carrier protein, heart/skeletal muscle isoform T1
Adenine nucleotide translocator 1
Short name:
ANT 1
Solute carrier family 25 member 4
mANC1
Gene: Slc25a4 |
| UniProt ID | P48962 |
| GO terms | GO:0005347 ATP transmembrane transporter activity
GO:0005471 ATP:ADP antiporter activity
GO:0005515 protein binding
GO:0005739 mitochondrion
GO:0005743 mitochondrial inner membrane
GO:0008637 apoptotic mitochondrial changes
GO:0010667 negative regulation of cardiac muscle cell apoptotic process
GO:0015866 ADP transport
GO:0016020 membrane
GO:0016021 integral component of membrane
GO:0019899 enzyme binding
GO:0032592 integral component of mitochondrial membrane
GO:0043209 myelin sheath
GO:0045121 membrane raft
GO:0055085 transmembrane transport
GO:0060546 negative regulation of necroptotic process
GO:0061051 positive regulation of cell growth involved in cardiac muscle cell development
GO:0140021 mitochondrial ADP transmembrane transport
GO:1902109 negative regulation of mitochondrial membrane permeability involved in apoptotic process
GO:1990544 mitochondrial ATP transmembrane transport
GO:2000277 positive regulation of oxidative phosphorylation uncoupler activity |
| Organisms for which functions have been demonstrated | Mus musculus (Mouse, mammal) |
| Sequence length | 298 amino acids |
| FASTA sequence | >sp|P48962|ADT1_MOUSE ADP/ATP translocase 1 OS=Mus musculus OX=10090 GN=Slc25a4 PE=1 SV=4
MGDQALSFLKDFLAGGIAAAVSKTAVAPIERVKLLLQVQHASKQISAEKQYKGIIDCVVRIPKEQGFLSFWRGNLANVIRYFPTQALNFAFKDKYKQIFLGGVDRHKQFWRYFAGNLASGGAAGATSLCFVYPLDFARTRLAADVGKGSSQREFNGLGDCLTKIFKSDGLKGLYQGFSVSVQGIIIYRAAYFGVYDTAKGMLPDPKNVHIIVSWMIAQSVTAVAGLVSYPFDTVRRRMMMQSGRKGADIMYTGTLDCWRKIAKDEGANAFFKGAWSNVLRGMGGAFVLVLYDEIKKYV |
| Structure Information |
| PDB ID | 1OKC_A |
| Quaternary structure | NA |
| SCOP | NA |
| CATH | NA |
| TM Helix Prediction | 3 (112-134, 172-194, 209-231) |
| DisProt Annotation | Not in DisProt |
| Predicted Disorder Regions | Predicted disorder at N terminus (aa 1-3) |
| Connections to Disease |
| OMIM ID | |
| Function 1 |
| Function description | adenine nucleotide translocator, ADP/ATP exchanger, mitochondria |
| References for function | 31618756 |
| E.C. number | NA |
| Location of functional site(s) | NA |
| Cellular location of function | Inner Membrane of the Mitochondria |
| Comments | NA |
| Function 2 |
| Function description | Interacts with TIM44 protein and affects the activity of the TIM23 complex |
| References for function | 31618756 |
| E.C. number | NA |
| Location of functional site(s) | NA |
| Cellular location of function | NA |
| Comments | NA |