| General Information |
| MoonProt ID | 442 |
| First appeared in release | 3.0 |
| Name(s) | KAT8 regulatory NSL complex subunit 1, Gene = KANSL1 |
| UniProt ID | Q7Z3B3 (KANL1_HUMAN) |
| GO terms | GO:0000123 histone acetyltransferase complex
GO:0000775 chromosome, centromeric region
GO:0000776 kinetochore
GO:0000777 condensed chromosome kinetochore
GO:0005515 protein binding
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005694 chromosome
GO:0006325 chromatin organization
GO:0035035 histone acetyltransferase binding
GO:0043981 histone H4-K5 acetylation
GO:0043982 histone H4-K8 acetylation
GO:0043984 histone H4-K16 acetylation
GO:0043995 histone acetyltransferase activity (H4-K5 specific)
GO:0043996 histone acetyltransferase activity (H4-K8 specific)
GO:0044545 NSL complex
GO:0046972 histone acetyltransferase activity (H4-K16 specific)
GO:0071339 MLL1 complex
|
| Organisms for which functions have been demonstrated | Homo sapiens (human, a mammal) |
| Sequence length | 1105 amino acids |
| FASTA sequence | >sp|Q7Z3B3|KANL1_HUMAN KAT8 regulatory NSL complex subunit 1 OS=Homo sapiens OX=9606 GN=KANSL1 PE=1 SV=2
MAAMAPALTDAAAEAHHIRFKLAPPSSTLSPGSAENNGNANILIAANGTKRKAIAAEDPS
LDFRNNPTKEDLGKLQPLVASYLCSDVTSVPSKESLKLQGVFSKQTVLKSHPLLSQSYEL
RAELLGRQPVLEFSLENLRTMNTSGQTALPQAPVNGLAKKLTKSSTHSDHDNSTSLNGGK
RALTSSALHGGEMGGSESGDLKGGMTNCTLPHRSLDVEHTTLYSNNSTANKSSVNSMEQP
ALQGSSRLSPGTDSSSNLGGVKLEGKKSPLSSILFSALDSDTRITALLRRQADIESRARR
LQKRLQVVQAKQVERHIQHQLGGFLEKTLSKLPNLESLRPRSQLMLTRKAEAALRKAASE
TTTSEGLSNFLKSNSISEELERFTASGIANLRCSEQAFDSDVTDSSSGGESDIEEEELTR
ADPEQRHVPLRRRSEWKWAADRAAIVSRWNWLQAHVSDLEYRIRQQTDIYKQIRANKGLI
VLGEVPPPEHTTDLFLPLSSEVKTDHGTDKLIESVSQPLENHGARIIGHISESLSTKSCG
ALRPVNGVINTLQPVLADHIPGDSSDAEEQLHKKQRLNLVSSSSDGTCVAARTRPVLSCK
KRRLVRPNSIVPLSKKVHRNSTIRPGCDVNPSCALCGSGSINTMPPEIHYEAPLLERLSQ
LDSCVHPVLAFPDDVPTSLHFQSMLKSQWQNKPFDKIKPPKKLSLKHRAPMPGSLPDSAR
KDRHKLVSSFLTTAKLSHHQTRPDRTHRQHLDDVGAVPMVERVTAPKAERLLNPPPPVHD
PNHSKMRLRDHSSERSEVLKHHTDMSSSSYLAATHHPPHSPLVRQLSTSSDSPAPASSSS
QVTASTSQQPVRRRRGESSFDINNIVIPMSVAATTRVEKLQYKEILTPSWREVDLQSLKG
SPDEENEEIEDLSDAAFAALHAKCEEMERARWLWTTSVPPQRRGSRSYRSSDGRTTPQLG
SANPSTPQPASPDVSSSHSLSEYSHGQSPRSPISPELHSAPLTPVARDTPRHLASEDTRC
STPELGLDEQSVQPWERRTFPLAHSPQAECEDQLDAQERAARCTRRTSGSKTGRETEAAP
TSPPIVPLKSRHLVAAATAQRPTHR |
| Structure Information |
| PDB ID | None |
| Quaternary structure | NA |
| SCOP | NA |
| CATH | NA |
| TM Helix Prediction | no TM helices |
| DisProt Annotation | Not in DisProt |
| Predicted Disorder Regions | Use FASTA sequence on the MFDp2 webserver.
moonID_442_uniID_Q7Z3B3 is 1105 residues long, with 1049 residues (94.93%) predicted as disordered.The protein has 0 short (< 30 residues) disorder segments and 4 long (>= 30 residues) disorder segments.
Segment 1 - Long (>= 30 residues) disordered segment Segment is located between positions 1 and 308 in the sequence. The segment is 308 residues long (27.87 % of the total sequence length).
Segment 2 - Long (>= 30 residues) disordered segment Segment is located between positions 330 and 378 in the sequence. The segment is 49 residues long (4.43 % of the total sequence length).
Segment 3 - Long (>= 30 residues) disordered segment Segment is located between positions 390 and 456 in the sequence. The segment is 67 residues long (6.06 % of the total sequence length).
Segment 4 - Long (>= 30 residues) disordered segment Segment is located between positions 481 and 1105 in the sequence. The segment is 625 residues long (56.56 % of the total sequence length). |
| Connections to Disease |
| OMIM ID | |
| Function 1 |
| Function description | part of the NSL complex, which acetylates nucleosomal histone H4 on lysine residues |
| References for function | 20018852 |
| E.C. number | NA |
| Location of functional site(s) | NA |
| Cellular location of function | nucleus |
| Comments | NA |
| Function 2 |
| Function description | KANSL1 and KANSL3 bind MT minus ends, also bind TPX2, MCAK |
| References for function | 22081094 |
| E.C. number | NA |
| Location of functional site(s) | NA |
| Cellular location of function | spindle poles |
| Comments | NA |