| General Information |
| MoonProt ID | 448 |
| First appeared in release | 3.0 |
| Name(s) | Prx, peroxiredoxin, Gene: D915_05992, FhPrx |
| UniProt ID | A0A2H1CGV5 (A0A2H1CGV5_FASHE) |
| GO terms | GO:0055114 oxidation-reduction process
GO:0016209 antioxidant activity
GO:0016491 oxidoreductase activity
GO:0051920 peroxiredoxin activity
GO:0098869 cellular oxidant detoxification
|
| Organisms for which functions have been demonstrated | Fasciola hepatica |
| Sequence length | 278 amino acids |
| FASTA sequence | >tr|A0A2H1CGV5|A0A2H1CGV5_FASHE Antioxidant, AhpC/TSA family OS=Fasciola hepatica OX=6192 GN=D915_05992 PE=4 SV=1
MKSTSATMLSSSLIIVLIASWVRLIMCDRDQCSPGRHPLPHSHPHLQRPMLQPNMPAPNFSGQAVVGKEFKTISLSDYKGKWVILAFYPLDFTFVCPTEIIAFSDQMEQFARRNCAVIFCSTDSVYSHLQWTKMDRKVGGIGQLNFPLLADKNMSISRAYGVLDEEQGNTYRTFSLSPGMDSGRKTFQTLLSVYHTELTVVLSSLFSGNFLIDPKGVLRQITVNDRPVGRSVEEALRLLDAFIFHEEHGEVCPANWKPKSKTIVPTPDGSKAYFSSAN |
| Structure Information |
| PDB ID | NA |
| Quaternary structure | monomeric, dimeric |
| SCOP | NA |
| CATH | NA |
| TM Helix Prediction | no TM helices |
| DisProt Annotation | Not in DisProt |
| Predicted Disorder Regions | Predicted disorder at N terminus (aa 1-4), middle region (aa 65, 70-78, 353-358, 436-462), and C terminus (aa 683-686) |
| Connections to Disease |
| OMIM ID | |
| Function 1 |
| Function description | Peroxiredoxin, antioxidant activity, reduction of H2O2, protection from ROS |
| References for function | Donnelly S, Stack CM, O'Neill SM, Sayed AA, Williams DL, Dalton JP. Helminth 2-Cys peroxiredoxin drives Th2 responses through a mechanism involving alternatively activated macrophages.FASEB J. 2008 22(11):4022-32. doi: 10.1096/fj.08-106278. PMID: 18708590 PMCID: PMC3980656 DOI: 10.1096/fj.08-106278
|
| E.C. number | |
| Location of functional site(s) | Cys47 Cys96, and Cys170 |
| Cellular location of function | cytoplasm |
| Comments | NA |
| Function 2 |
| Function description | cytokine, Induces expression and production of Ym1 in macrophages, promotes polarization of Th2 response |
| References for function | Donnelly S, Stack CM, O'Neill SM, Sayed AA, Williams DL, Dalton JP. Helminth 2-Cys peroxiredoxin drives Th2 responses through a mechanism involving alternatively activated macrophages.FASEB J. 2008 Nov;22(11):4022-32. doi: 10.1096/fj.08-106278. PMID: 18708590 PMCID: PMC3980656 DOI: 10.1096/fj.08-106278
|
| E.C. number | NA |
| Location of functional site(s) | NA |
| Cellular location of function | extracellular |
| Comments | cytokine function is independent of peroxidase activity |