General Information |
MoonProt ID | 448 |
First appeared in release | 3.0 |
Name(s) | Prx, peroxiredoxin, Gene: D915_05992, FhPrx |
UniProt ID | A0A2H1CGV5 (A0A2H1CGV5_FASHE) |
GO terms | GO:0055114 oxidation-reduction process
GO:0016209 antioxidant activity
GO:0016491 oxidoreductase activity
GO:0051920 peroxiredoxin activity
GO:0098869 cellular oxidant detoxification
|
Organisms for which functions have been demonstrated | Fasciola hepatica |
Sequence length | 278 amino acids |
FASTA sequence | >tr|A0A2H1CGV5|A0A2H1CGV5_FASHE Antioxidant, AhpC/TSA family OS=Fasciola hepatica OX=6192 GN=D915_05992 PE=4 SV=1
MKSTSATMLSSSLIIVLIASWVRLIMCDRDQCSPGRHPLPHSHPHLQRPMLQPNMPAPNFSGQAVVGKEFKTISLSDYKGKWVILAFYPLDFTFVCPTEIIAFSDQMEQFARRNCAVIFCSTDSVYSHLQWTKMDRKVGGIGQLNFPLLADKNMSISRAYGVLDEEQGNTYRTFSLSPGMDSGRKTFQTLLSVYHTELTVVLSSLFSGNFLIDPKGVLRQITVNDRPVGRSVEEALRLLDAFIFHEEHGEVCPANWKPKSKTIVPTPDGSKAYFSSAN |
Structure Information |
PDB ID | NA |
Quaternary structure | monomeric, dimeric |
SCOP | NA |
CATH | NA |
TM Helix Prediction | no TM helices |
DisProt Annotation | Not in DisProt |
Predicted Disorder Regions | Use FASTA sequence on the MFDp2 webserver.
moonID_448_uniID_A0A2H1C is 278 residues long, with 19 residues (6.83%) predicted as disordered.The protein has 2 short (< 30 residues) disorder segments and 0 long (>= 30 residues) disorder segments.
Segment 1 - Short (< 30 residues) disordered segment Segment is located between positions 33 and 47 in the sequence. The segment is 15 residues long (5.40 % of the total sequence length).
Segment 2 - Short (< 30 residues) disordered segment Segment is located between positions 275 and 278 in the sequence. The segment is 4 residues long (1.44 % of the total sequence length). |
Connections to Disease |
OMIM ID | |
Function 1 |
Function description | Peroxiredoxin, antioxidant activity, reduction of H2O2, protection from ROS |
References for function | Donnelly S, Stack CM, O'Neill SM, Sayed AA, Williams DL, Dalton JP. Helminth 2-Cys peroxiredoxin drives Th2 responses through a mechanism involving alternatively activated macrophages.FASEB J. 2008 22(11):4022-32. doi: 10.1096/fj.08-106278. PMID: 18708590 PMCID: PMC3980656 DOI: 10.1096/fj.08-106278
|
E.C. number | NA |
Location of functional site(s) | Cys47 Cys96, and Cys170 |
Cellular location of function | cytoplasm |
Comments | NA |
Function 2 |
Function description | cytokine, Induces expression and production of Ym1 in macrophages, promotes polarization of Th2 response |
References for function | Donnelly S, Stack CM, O'Neill SM, Sayed AA, Williams DL, Dalton JP. Helminth 2-Cys peroxiredoxin drives Th2 responses through a mechanism involving alternatively activated macrophages.FASEB J. 2008 Nov;22(11):4022-32. doi: 10.1096/fj.08-106278. PMID: 18708590 PMCID: PMC3980656 DOI: 10.1096/fj.08-106278
|
E.C. number | NA |
Location of functional site(s) | NA |
Cellular location of function | extracellular |
Comments | cytokine function is independent of peroxidase activity |