General Information |
MoonProt ID | 458 |
First appeared in release | 3.0 |
Name(s) | EF-Tu
Elongation factor Tu |
UniProt ID | Q8G5B7 (EFTU_BIFLO) |
GO terms | GO:0005525 GTP binding
GO:0006412 translation
GO:0003746 translation elongation factor activity
GO:0006414 translational elongation
GO:0005737 cytoplasm
GO:0000166 nucleotide binding |
Organisms for which functions have been demonstrated | Bifidobacterium longum (strain NCC 2705) (Gram positive bacterium) |
Sequence length | 399 amino acids |
FASTA sequence | >sp|Q8G5B7|EFTU_BIFLO Elongation factor Tu OS=Bifidobacterium longum (strain NCC 2705) OX=206672 GN=tuf PE=3 SV=1
MAKEKYERTKPHVNIGTIGHVDHGKTTLTAAISKVLHEEFPDVNPEYDFNQIDSAPEEAARGITINIAHIEYQTEKRHYAHVDCPGHADFVKNMITGAAQMDGAILVVAATDGPMAQTREHVLLARQVGVPKILVALNKCDMVDDEELIELVEEEVRDLLDENGFDRDCPVIHTSAYGALHDDAPDHEKWVQSVKDLMDAVDDYIPTPVHDLDKPFLMPIEDVFTISGRGTVVTGRVERGQLAVNTPVEIVGIRPTQQTTVTSIETFHKTMDACEAGDNTGLLLRGLGRDDVERGQVVAKPGSVTPHTKFEGEVYVLTKDEGGRHSPFFSNYRPQFYFRTTDVTGVIELPEGVEMVQPGDHATFTVELIQPIAMEEGLTFAVREGGHTVGSGRVTKILA |
Structure Information |
PDB ID | NA |
Quaternary structure | NA |
SCOP | |
CATH | |
TM Helix Prediction | no TM helices
# sp|Q8G5B7|EFTU_BIFLO Number of predicted TMHs: 0
# sp|Q8G5B7|EFTU_BIFLO Exp number of AAs in TMHs: 0.04281
# sp|Q8G5B7|EFTU_BIFLO Exp number, first 60 AAs: 0.00183
# sp|Q8G5B7|EFTU_BIFLO Total prob of N-in: 0.08519
sp|Q8G5B7|EFTU_BIFLO TMHMM2.0 outside 1 399 |
DisProt Annotation | Not in DisProt |
Predicted Disorder Regions | Use FASTA sequence on MFDp2 webserver.
spQ8G5B7EFTU_BIFLO_Elong is 399 residues long, with 17 residues (4.26 %) predicted as disordered. The protein has 1 short (< 30 residues) disorder segment and 0 long (>= 30 residues) disorder segments.
Segment 1 - Short (< 30 residues) disordered segment
Segment is located between positions 1 and 17 in the sequence.
The segment is 17 residues long (4.26 % of the total sequence length). |
Connections to Disease |
OMIM ID | |
Function 1 |
Function description | elognation factor |
References for function | Ventura M, Canchaya C, Meylan V, Klaenhammer TR, Zink R. Analysis, characterization, and loci of the tuf genes in lactobacillus and bifidobacterium species and their direct application for species identification. Appl Environ Microbiol. 2003 Nov;69(11):6908-22. doi: 10.1128/aem.69.11.6908-6922.2003. PMID: 14602655; PMCID: PMC262312. |
E.C. number | |
Location of functional site(s) | |
Cellular location of function | cytoplasm |
Comments | |
Function 2 |
Function description | binds mucin |
References for function | Nishiyama K, Takaki T, Sugiyama M, Fukuda I, Aiso M, Mukai T, Odamaki T, Xiao JZ, Osawa R, Okada N. Extracellular vesicles produced by Bifidobacterium longum export mucin-binding proteins. Appl Environ Microbiol. 2020 Jul 31:AEM.01464-20. doi: 10.1128/AEM.01464-20. Epub ahead of print. PMID: 32737132. |
E.C. number | |
Location of functional site(s) | |
Cellular location of function | extracellular |
Comments | |