General Information |
MoonProt ID | 479 |
First appeared in release | 3.0 |
Name(s) | riboflavin kinase/regulator (RbkR) |
UniProt ID | NA |
GO terms | NA |
Organisms for which functions have been demonstrated | Pyrobaculum yellowstonensis WP30 |
Sequence length | 210 aa |
FASTA sequence | >AKT35049.1 CTP-dependent riboflavin kinase [Pyrobaculum sp. WP30]
MECVDRRLVGDLLALSRVEGLPVAEAAGRLCMTRQGLYKILRSLRERGYVEEGPVVKLSQRGRDILSAALRELLSYFNIASIRVVGVVVSGLGEGAFYISLEGYRRVMEELLGFVPYPGTLNVKLDPQSLPYRRYLESLPGILIPGFTNGMRTYGAVKAFRARIRGVEGAVVMPERTHHPTDVIEVVASVKLRDVLGLRDGDKVEIEIYL |
Structure Information |
PDB ID | NA |
Quaternary structure | NA |
SCOP | |
CATH | |
TM Helix Prediction | no TM helices
# AKT35049.1 Number of predicted TMHs: 0
# AKT35049.1 Exp number of AAs in TMHs: 9.79469
# AKT35049.1 Exp number, first 60 AAs: 0.01017
# AKT35049.1 Total prob of N-in: 0.29912
AKT35049.1 TMHMM2.0 outside 1 210 |
DisProt Annotation | |
Predicted Disorder Regions | Use FASTA sequence on MFDp2 webserver.
AKT35049_1_CTP_dependent is 210 residues long, with 0 residues (0.00 %) predicted as disordered. The protein has 0 short (< 30 residues) disorder segments and 0 long (>= 30 residues) disorder segments. |
Connections to Disease |
OMIM ID | |
Function 1 |
Function description | CTP-dependent riboflavin kinase |
References for function | Rodionova IA, Vetting MW, Li X, Almo SC, Osterman AL, Rodionov DA. A novel bifunctional transcriptional regulator of riboflavin metabolism in Archaea. Nucleic Acids Res. 2017 Apr 20;45(7):3785-3799. doi: 10.1093/nar/gkw1331. PMID: 28073944; PMCID: PMC5397151. |
E.C. number | |
Location of functional site(s) | |
Cellular location of function | |
Comments | RbkR proteins are composedof the riboflavin kinase domain and a DNA-bindingwinged helix-turn-helix-like domain |
Function 2 |
Function description | DNA binding protein.
Transcriptional regulator of riboflavin metabolism, PF12802 archael. |
References for function | Rodionova IA, Vetting MW, Li X, Almo SC, Osterman AL, Rodionov DA. A novel bifunctional transcriptional regulator of riboflavin metabolism in Archaea. Nucleic Acids Res. 2017 Apr 20;45(7):3785-3799. doi: 10.1093/nar/gkw1331. PMID: 28073944; PMCID: PMC5397151. |
E.C. number | |
Location of functional site(s) | |
Cellular location of function | |
Comments | |