| General Information |
| MoonProt ID | 479 |
| First appeared in release | 3.0 |
| Name(s) | riboflavin kinase/regulator (RbkR) |
| UniProt ID | NA |
| GO terms | NA |
| Organisms for which functions have been demonstrated | Pyrobaculum yellowstonensis WP30 |
| Sequence length | 210 aa |
| FASTA sequence | >AKT35049.1 CTP-dependent riboflavin kinase [Pyrobaculum sp. WP30]
MECVDRRLVGDLLALSRVEGLPVAEAAGRLCMTRQGLYKILRSLRERGYVEEGPVVKLSQRGRDILSAALRELLSYFNIASIRVVGVVVSGLGEGAFYISLEGYRRVMEELLGFVPYPGTLNVKLDPQSLPYRRYLESLPGILIPGFTNGMRTYGAVKAFRARIRGVEGAVVMPERTHHPTDVIEVVASVKLRDVLGLRDGDKVEIEIYL |
| Structure Information |
| PDB ID | NA |
| Quaternary structure | NA |
| SCOP | |
| CATH | |
| TM Helix Prediction | no TM helices
# AKT35049.1 Number of predicted TMHs: 0
# AKT35049.1 Exp number of AAs in TMHs: 9.79469
# AKT35049.1 Exp number, first 60 AAs: 0.01017
# AKT35049.1 Total prob of N-in: 0.29912
AKT35049.1 TMHMM2.0 outside 1 210 |
| DisProt Annotation | |
| Predicted Disorder Regions | Use FASTA sequence on MFDp2 webserver.
AKT35049_1_CTP_dependent is 210 residues long, with 0 residues (0.00 %) predicted as disordered. The protein has 0 short (< 30 residues) disorder segments and 0 long (>= 30 residues) disorder segments. |
| Connections to Disease |
| OMIM ID | |
| Function 1 |
| Function description | CTP-dependent riboflavin kinase |
| References for function | Rodionova IA, Vetting MW, Li X, Almo SC, Osterman AL, Rodionov DA. A novel bifunctional transcriptional regulator of riboflavin metabolism in Archaea. Nucleic Acids Res. 2017 Apr 20;45(7):3785-3799. doi: 10.1093/nar/gkw1331. PMID: 28073944; PMCID: PMC5397151. |
| E.C. number | |
| Location of functional site(s) | |
| Cellular location of function | |
| Comments | RbkR proteins are composedof the riboflavin kinase domain and a DNA-bindingwinged helix-turn-helix-like domain |
| Function 2 |
| Function description | DNA binding protein.
Transcriptional regulator of riboflavin metabolism, PF12802 archael. |
| References for function | Rodionova IA, Vetting MW, Li X, Almo SC, Osterman AL, Rodionov DA. A novel bifunctional transcriptional regulator of riboflavin metabolism in Archaea. Nucleic Acids Res. 2017 Apr 20;45(7):3785-3799. doi: 10.1093/nar/gkw1331. PMID: 28073944; PMCID: PMC5397151. |
| E.C. number | |
| Location of functional site(s) | |
| Cellular location of function | |
| Comments | |