| General Information |
| MoonProt ID | 484 |
| First appeared in release | 3.0 |
| Name(s) | DNA-(apurinic or apyrimidinic site) endonuclease; APEX1; Redox factor 1 |
| UniProt ID | P27695 (APEX1_HUMAN) |
| GO terms | GO:0003713 transcription coactivator activity
GO:0045944 positive regulation of transcription by RNA polymerase II
GO:0005634 nucleus
GO:0006284 base-excision repair
GO:0003906 DNA-(apurinic or apyrimidinic site) endonuclease activity
GO:0004528 phosphodiesterase I activity
GO:0005634 nucleus
GO:0008311 double-stranded DNA 3'-5' exodeoxyribonuclease activity
GO:0006281 DNA repair
GO:0005730 nucleolus
GO:0005654 nucleoplasm
GO:0080111 DNA demethylation
GO:0031490 chromatin DNA binding
GO:0016491 oxidoreductase activity
GO:0008408 3'-5' exonuclease activity
GO:0005739 mitochondrion
GO:0003684 damaged DNA binding
GO:0042981 regulation of apoptotic process
GO:0016890 site-specific endodeoxyribonuclease activity |
| Organisms for which functions have been demonstrated | Homo sapiens (Human) |
| Sequence length | 318 amino acids |
| FASTA sequence | >sp|P27695|APEX1_HUMAN DNA-(apurinic or apyrimidinic site) endonuclease OS=Homo sapiens OX=9606 GN=APEX1 PE=1 SV=2
MPKRGKKGAVAEDGDELRTEPEAKKSKTAAKKNDKEAAGEGPALYEDPPDQKTSPSGKPATLKICSWNVDGLRAWIKKKGLDWVKEEAPDILCLQETKCSENKLPAELQELPGLSHQYWSAPSDKEGYSGVGLLSRQCPLKVSYGIGDEEHDQEGRVIVAEFDSFVLVTAYVPNAGRGLVRLEYRQRWDEAFRKFLKGLASRKPLVLCGDLNVAHEEIDLRNPKGNKKNAGFTPQERQGFGELLQAVPLADSFRHLYPNTPYAYTFWTYMMNARSKNVGWRLDYFLLSHSLLPALCDSKIRSKALGSDHCPITLYLAL |
| Structure Information |
| PDB ID | 1BIX, chain A, aa 32-318 |
| Quaternary structure | homodimer |
| SCOP | |
| CATH | |
| TM Helix Prediction | no TM helices
# sp|P27695|APEX1_HUMAN Number of predicted TMHs: 0
# sp|P27695|APEX1_HUMAN Exp number of AAs in TMHs: 0.04243
# sp|P27695|APEX1_HUMAN Exp number, first 60 AAs: 0
# sp|P27695|APEX1_HUMAN Total prob of N-in: 0.05054
sp|P27695|APEX1_HUMAN TMHMM2.0 outside 1 318 |
| DisProt Annotation | |
| Predicted Disorder Regions | Use FASTA sequence on the MFDp2 webserver.
sp_P27695_APEX1_HUMAN_DN is 318 residues long, with 63 residues (19.81 %) predicted as disordered. The protein has 0 short (< 30 residues) disorder segments and 1 long (>= 30 residues) disorder segment.
Segment 1 - Long (>= 30 residues) disordered segment
Segment is located between positions 1 and 63 in the sequence.
The segment is 63 residues long (19.81 % of the total sequence length).
|
| Connections to Disease |
| OMIM ID | |
| Function 1 |
| Function description | DNA repair |
| References for function | Ramotar D. The apurinic–apyrimidinic endonuclease IV family of DNA repair enzymes. Biochemistry and cell biology. 1997 Aug 1;75(4):327-36. |
| E.C. number | NA |
| Location of functional site(s) | |
| Cellular location of function | nucleus |
| Comments | apurinic/apyrimidinic (AP) endodeoxyribonuclease in the DNA base excision repair (BER) pathway |
| Function 2 |
| Function description | redox regulation of transcriptional factors |
| References for function | Acharya A, Das I, Chandhok D, Saha T. Redox regulation in cancer: a double-edged sword with therapeutic potential. Oxidative medicine and cellular longevity. 2010 Jan 1;3(1):23-34. |
| E.C. number | |
| Location of functional site(s) | |
| Cellular location of function | nucleus |
| Comments | |