| General Information |
| MoonProt ID | 496 |
| First appeared in release | 3.0 |
| Name(s) | Protein S100-A9
Gene: S100A9 Synonyms:CAGB, CFAG, MRP14
Recommended name:
Protein S100-A9
Alternative name(s):
Calgranulin-B
Calprotectin L1H subunit
Leukocyte L1 complex heavy chain
Migration inhibitory factor-related protein 14
Short name:
MRP-14
Short name:
p14
S100 calcium-binding protein A9 |
| UniProt ID | P06702 (S10A9_HUMAN) |
| GO terms | GO:0070488 neutrophil aggregation
GO:0006914 autophagy
GO:0050729 positive regulation of inflammatory response
GO:0030593 neutrophil chemotaxis
GO:0006919 activation of cysteine-type endopeptidase activity involved in apoptotic process
GO:0002523 leukocyte migration involved in inflammatory response
GO:0042742 defense response to bacterium
GO:0035662 Toll-like receptor 4 binding
GO:0032602 chemokine production
GO:0030307 positive regulation of cell growth
GO:0005886 plasma membrane
GO:0005856 cytoskeleton
GO:0001816 cytokine production
GO:0035606 peptidyl-cysteine S-trans-nitrosylation
GO:0051493 regulation of cytoskeleton organization
GO:0051092 positive regulation of NF-kappaB transcription factor activity
GO:0050832 defense response to fungus
GO:0050786 RAGE receptor binding
GO:0050544 arachidonic acid binding
GO:0032119 sequestering of zinc ion
GO:0008270 zinc ion binding
GO:0008017 microtubule binding
GO:0005829 cytosol
GO:0005576 extracellular region
GO:0005509 calcium ion binding
GO:0046872 metal ion binding
GO:0045087 innate immune response
GO:0002376 immune system process
GO:0005737 cytoplasm
GO:0006954 inflammatory response
GO:0006915 apoptotic process
GO:0006935 chemotaxis
GO:0016020 membrane
GO:0016209 antioxidant activity
GO:0005615 extracellular space
GO:0035821 modulation of process of other organism
GO:0061844 antimicrobial humoral immune response mediated by antimicrobial peptide
GO:2001244 positive regulation of intrinsic apoptotic signaling pathway
GO:0070062 extracellular exosome
GO:0005634 nucleus |
| Organisms for which functions have been demonstrated | Homo sapiens (Human) |
| Sequence length | 114 amino acids |
| FASTA sequence | >sp|P06702|S10A9_HUMAN Protein S100-A9 OS=Homo sapiens OX=9606 GN=S100A9 PE=1 SV=1
MTCKMSQLERNIETIINTFHQYSVKLGHPDTLNQGEFKELVRKDLQNFLKKENKNEKVIEHIMEDLDTNADKQLSFEEFIMLMARLTWASHEKMHEGDEGPGHHHKPGLGEGTP |
| Structure Information |
| PDB ID | 1IRJ
1XK4
4GGF
4XJK
5I8N
5W1F
6DS2 |
| Quaternary structure | NA |
| SCOP | 1 domain.
class 1000000 All alpha proteins
fold 2000120 Pair of EF Hands-like
superfamily 3001983 EF-hand
family 4000919 S100 proteins
domain 8021372 This domain is represented by 1XK4 C:4-86 Protein S100-A9. Species Homo sapiens. |
| CATH | 1 Matching CATH Superfamily.
Superfamily: 1.10.238.10. EF-hand.
8 Matching CATH Domains.
Domain: 1irjA00. PDB code 1irj, chain A, domain 00. Superfamily: 1.10.238.10.
Domain: 1irjB00. PDB code 1irj, chain B, domain 00. Superfamily: 1.10.238.10.
Domain: 1irjC00. PDB code 1irj, chain C, domain 00. Superfamily: 1.10.238.10.
Domain: 1irjD00. PDB code 1irj, chain D, domain 00. Superfamily: 1.10.238.10.
Domain: 1irjE00. PDB code 1irj, chain E, domain 00. Superfamily: 1.10.238.10.
Domain: 1irjF00. PDB code 1irj, chain F, domain 00. Superfamily: 1.10.238.10.
Domain: 1irjG00. PDB code 1irj, chain G, domain 00. Superfamily: 1.10.238.10.
Domain: 1irjH00. PDB code 1irj, chain H, domain 00. Superfamily: 1.10.238.10. |
| TM Helix Prediction | no TM helices
# sp|P06702|S10A9_HUMAN Number of predicted TMHs: 0
#er of AAs in TMHs: 0.00081
# sp|P06702|S10A9_HUMAN Exp number, first 60 AAs: 0
# sp|P06702|S10A9_HUMAN Total prob of N-in: 0.44390
sp|P06702|S10A9_HUMAN TMHMM2.0 outside 1 114 |
| DisProt Annotation | |
| Predicted Disorder Regions | Predicted disorder at N terminus (aa 1-6), and C terminus (aa 92-114) |
| Connections to Disease |
| OMIM ID | 123886 |
| Function 1 |
| Function description | binds to receptor, amplifies inflammation via Toll-like receptor four TLR4. |
| References for function | Harman JL, Loes AN, Warren GD, Heaphy MC, Lampi KJ, Harms MJ. Evolution of multifunctionality through a pleiotropic substitution in the innate immune protein S100A9. Elife. 2020 Apr 7;9:e54100. doi: 10.7554/eLife.54100. PMID: 32255429; PMCID: PMC7213983. |
| E.C. number | N/A |
| Location of functional site(s) | |
| Cellular location of function | |
| Comments | |
| Function 2 |
| Function description | part of a heterocomplex with S100A8 to drive inflammation, antimicrobial |
| References for function | Harman JL, Loes AN, Warren GD, Heaphy MC, Lampi KJ, Harms MJ. Evolution of multifunctionality through a pleiotropic substitution in the innate immune protein S100A9. Elife. 2020 Apr 7;9:e54100. doi: 10.7554/eLife.54100. PMID: 32255429; PMCID: PMC7213983. |
| E.C. number | |
| Location of functional site(s) | |
| Cellular location of function | |
| Comments | |