| General Information |
| MoonProt ID | 499 |
| First appeared in release | 3.0 |
| Name(s) | Cell division protein YtfB
Gene: ytfB |
| UniProt ID | P39310 (YTFB_ECOLI) |
| GO terms | GO:0051301 cell division
GO:0016020 membrane
GO:0005886 plasma membrane
GO:0016021 integral component of membrane
GO:0007049 cell cycle |
| Organisms for which functions have been demonstrated | Escherichia coli (strain K12) |
| Sequence length | 212 amino acids |
| FASTA sequence | >sp|P39310|YTFB_ECOLI Cell division protein YtfB OS=Escherichia coli (strain K12) OX=83333 GN=ytfB PE=3 SV=2
MPGRFELKPTLEKVWHAPDNFRFMDPLPPMHRRGIIIAAIVLVVGFLLPSDDTPNAPVVTREAQLDIQSQSQPPTEEQLRAQLVTPQNDPDQVAPVAPEPIQEGQPEEQPQTTQTQPFQPDSGIDNQWRSYRVEPGKTMAQLFRDHGLPATDVYAMAQVEGAGKPLSNLQNGQMVKIRQNASGVVTGLTIDTGNNQQVLFTRQPDGSFIRAR |
| Structure Information |
| PDB ID | na |
| Quaternary structure | NA |
| SCOP | |
| CATH | |
| TM Helix Prediction | no TM helices
# sp|P39310|YTFB_ECOLI Number of predicted TMHs: 0
# sp|P39310|YTFB_ECOLI Exp number of AAs in TMHs: 8.89444
# sp|P39310|YTFB_ECOLI Exp number, first 60 AAs: 8.88546
# sp|P39310|YTFB_ECOLI Total prob of N-in: 0.07546
sp|P39310|YTFB_ECOLI TMHMM2.0 outside 1 212 |
| DisProt Annotation | |
| Predicted Disorder Regions | Predicted disorder at N terminus (aa 1-7), middle region (aa 58-133), and C terminus (aa 205-212) |
| Connections to Disease |
| OMIM ID | |
| Function 1 |
| Function description | Cell division protein |
| References for function | Jorgenson MA, Young KD. YtfB, an OapA Domain-Containing Protein, Is a New Cell Division Protein in Escherichia coli. J Bacteriol. 2018 Jun 11;200(13):e00046-18. doi: 10.1128/JB.00046-18. PMID: 29686141; PMCID: PMC5996693. |
| E.C. number | N/A |
| Location of functional site(s) | |
| Cellular location of function | cytoplasm |
| Comments | |
| Function 2 |
| Function description | adhesin |
| References for function | Bottomley AL, Peterson E, Iosifidis G, Yong AMH, Hartley-Tassell LE, Ansari S, McKenzie C, Burke C, Duggin IG, Kline KA, Harry EJ. The novel E. coli cell division protein, YtfB, plays a role in eukaryotic cell adhesion. Sci Rep. 2020 Apr 21;10(1):6745. doi: 10.1038/s41598-020-63729-7. PMID: 32317661; PMCID: PMC7174318. |
| E.C. number | |
| Location of functional site(s) | |
| Cellular location of function | extracellular |
| Comments | |