General Information |
MoonProt ID | 499 |
First appeared in release | 3.0 |
Name(s) | Cell division protein YtfB
Gene: ytfB |
UniProt ID | P39310 (YTFB_ECOLI) |
GO terms | GO:0051301 cell division
GO:0016020 membrane
GO:0005886 plasma membrane
GO:0016021 integral component of membrane
GO:0007049 cell cycle |
Organisms for which functions have been demonstrated | Escherichia coli (strain K12) |
Sequence length | 212 amino acids |
FASTA sequence | >sp|P39310|YTFB_ECOLI Cell division protein YtfB OS=Escherichia coli (strain K12) OX=83333 GN=ytfB PE=3 SV=2
MPGRFELKPTLEKVWHAPDNFRFMDPLPPMHRRGIIIAAIVLVVGFLLPSDDTPNAPVVTREAQLDIQSQSQPPTEEQLRAQLVTPQNDPDQVAPVAPEPIQEGQPEEQPQTTQTQPFQPDSGIDNQWRSYRVEPGKTMAQLFRDHGLPATDVYAMAQVEGAGKPLSNLQNGQMVKIRQNASGVVTGLTIDTGNNQQVLFTRQPDGSFIRAR |
Structure Information |
PDB ID | na |
Quaternary structure | NA |
SCOP | |
CATH | |
TM Helix Prediction | no TM helices
# sp|P39310|YTFB_ECOLI Number of predicted TMHs: 0
# sp|P39310|YTFB_ECOLI Exp number of AAs in TMHs: 8.89444
# sp|P39310|YTFB_ECOLI Exp number, first 60 AAs: 8.88546
# sp|P39310|YTFB_ECOLI Total prob of N-in: 0.07546
sp|P39310|YTFB_ECOLI TMHMM2.0 outside 1 212 |
DisProt Annotation | |
Predicted Disorder Regions | Use FASTA sequence on the MFDp2 webserver.
spP39310YTFB_ECOLI_Cell_ is 212 residues long, with 132 residues (62.26 %) predicted as disordered. The protein has 3 short (< 30 residues) disorder segments and 1 long (>= 30 residues) disorder segment.
Segment 1 - Short (< 30 residues) disordered segment
Segment is located between positions 1 and 4 in the sequence.
The segment is 4 residues long (1.89 % of the total sequence length).
Segment 2 - Long (>= 30 residues) disordered segment
Segment is located between positions 52 and 139 in the sequence.
The segment is 88 residues long (41.51 % of the total sequence length).
Segment 3 - Short (< 30 residues) disordered segment
Segment is located between positions 152 and 172 in the sequence.
The segment is 21 residues long (9.91 % of the total sequence length).
Segment 4 - Short (< 30 residues) disordered segment
Segment is located between positions 194 and 212 in the sequence.
The segment is 19 residues long (8.96 % of the total sequence length). |
Connections to Disease |
OMIM ID | |
Function 1 |
Function description | Cell division protein |
References for function | Jorgenson MA, Young KD. YtfB, an OapA Domain-Containing Protein, Is a New Cell Division Protein in Escherichia coli. J Bacteriol. 2018 Jun 11;200(13):e00046-18. doi: 10.1128/JB.00046-18. PMID: 29686141; PMCID: PMC5996693. |
E.C. number | |
Location of functional site(s) | |
Cellular location of function | cytoplasm |
Comments | |
Function 2 |
Function description | adhesin |
References for function | Bottomley AL, Peterson E, Iosifidis G, Yong AMH, Hartley-Tassell LE, Ansari S, McKenzie C, Burke C, Duggin IG, Kline KA, Harry EJ. The novel E. coli cell division protein, YtfB, plays a role in eukaryotic cell adhesion. Sci Rep. 2020 Apr 21;10(1):6745. doi: 10.1038/s41598-020-63729-7. PMID: 32317661; PMCID: PMC7174318. |
E.C. number | |
Location of functional site(s) | |
Cellular location of function | extracellular |
Comments | |