| General Information |
| MoonProt ID | 502 |
| First appeared in release | 3.0 |
| Name(s) | U4/U6 small nuclear ribonucleoprotein Prp31 |
| UniProt ID | Q8WWY3 (PRP31_HUMAN) |
| GO terms | GO:0000244 spliceosomal tri-snRNP complex assembly
GO:0000398 mRNA splicing, via spliceosome
GO:0003723 RNA binding
GO:0005515 protein binding
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005681 spliceosomal complex
GO:0005684 U2-type spliceosomal complex
GO:0005687 U4 snRNP
GO:0005690 U4atac snRNP
GO:0006397 mRNA processing
GO:0008380 RNA splicing
GO:0015030 Cajal body
GO:0016607 nuclear speck
GO:0030621 U4 snRNA binding
GO:0030622 U4atac snRNA binding
GO:0042802 identical protein binding
GO:0043021 ribonucleoprotein complex binding
GO:0046540 U4/U6 x U5 tri-snRNP complex
GO:0048254 snoRNA localization
GO:0070990 snRNP binding
GO:0071005 U2-type precatalytic spliceosome
GO:0071011 precatalytic spliceosome
GO:0071166 ribonucleoprotein complex localization
GO:0071339 MLL1 complex
GO:0097526 spliceosomal tri-snRNP complex
|
| Organisms for which functions have been demonstrated | Homo sapiens (human, a mammal) |
| Sequence length | 499 amino acids |
| FASTA sequence | >sp|Q8WWY3|PRP31_HUMAN U4/U6 small nuclear ribonucleoprotein Prp31 OS=Homo sapiens OX=9606 GN=PRPF31 PE=1 SV=2
MSLADELLADLEEAAEEEEGGSYGEEEEEPAIEDVQEETQLDLSGDSVKTIAKLWDSKMF
AEIMMKIEEYISKQAKASEVMGPVEAAPEYRVIVDANNLTVEIENELNIIHKFIRDKYSK
RFPELESLVPNALDYIRTVKELGNSLDKCKNNENLQQILTNATIMVVSVTASTTQGQQLS
EEELERLEEACDMALELNASKHRIYEYVESRMSFIAPNLSIIIGASTAAKIMGVAGGLTN
LSKMPACNIMLLGAQRKTLSGFSSTSVLPHTGYIYHSDIVQSLPPDLRRKAARLVAAKCT
LAARVDSFHESTEGKVGYELKDEIERKFDKWQEPPPVKQVKPLPAPLDGQRKKRGGRRYR
KMKERLGLTEIRKQANRMSFGEIEEDAYQEDLGFSLGHLGKSGSGRVRQTQVNEATKARI
SKTLQRTLQKQSVVYGGKSTIRDRSSGTASSVAFTPLQGLEIVNPQAAEKKVAEANQKYF
SSMAEFLKVKGEKSGLMST |
| Structure Information |
| PDB ID | 3JCR, 2OZB, 3SIU |
| Quaternary structure | NA |
| SCOP | NA |
| CATH | NA |
| TM Helix Prediction | no TM helices |
| DisProt Annotation | Not in DisProt |
| Predicted Disorder Regions | NA |
| Connections to Disease |
| OMIM ID | |
| Function 1 |
| Function description | component of the spliceosome |
| References for function | 11867543 28781166 |
| E.C. number | NA |
| Location of functional site(s) | NA |
| Cellular location of function | cytoplasm, spliceosome |
| Comments | NA |
| Function 2 |
| Function description | binds Ndc80/HEC1, without it see Morphologically irregular spindles; defective chromosome congression at metaphase |
| References for function | 30475206 15142036 |
| E.C. number | NA |
| Location of functional site(s) | NA |
| Cellular location of function | mitotic spindle |
| Comments | NA |