| General Information |
| MoonProt ID | 504 |
| First appeared in release | 3.0 |
| Name(s) | Pre-mRNA-processing factor 31
Gene
Prp31 |
| UniProt ID | Q9VUM1 (Q9VUM1_DROME) |
| GO terms | GO TERM GO NAME
GO:0000244 spliceosomal tri-snRNP complex assembly
GO:0000398 mRNA splicing, via spliceosome
GO:0000398 mRNA splicing, via spliceosome
GO:0000398 mRNA splicing, via spliceosome
GO:0000398 mRNA splicing, via spliceosome
GO:0003723 RNA binding
GO:0003723 RNA binding
GO:0005634 nucleus
GO:0005681 spliceosomal complex
GO:0005681 spliceosomal complex
GO:0005687 U4 snRNP
GO:0006397 mRNA processing
GO:0008380 RNA splicing
GO:0043021 ribonucleoprotein complex binding
GO:0046540 U4/U6 x U5 tri-snRNP complex
GO:0071011 precatalytic spliceosome
GO:0071011 precatalytic spliceosome
GO:0097526 spliceosomal tri-snRNP complex |
| Organisms for which functions have been demonstrated | Drosophila melanogaster (fruit fly, an insect) |
| Sequence length | 501 amino acids |
| FASTA sequence | >tr|Q9VUM1|Q9VUM1_DROME Pre-mRNA-processing factor 31 OS=Drosophila melanogaster OX=7227 GN=Prp31 PE=1 SV=1
MSLADELLADLEEDNDNELEEEDSEMASAEDESLLAEKLAKPAPNLMDVDVTVQSVRELC
KLRDSERLKNTLQQIEHYASRQRTAAEMLGSVESDPEYCLIVDANAIAVDIDNEISIVHK
FTKEKYQKRFPELDSLIVGEIEYLLAVKELGNDLDQVKNNEKLQAILTQATIMIVSVTAS
TTQGTMLTPAEKAKIDEACEMAIELNNFKSKIYEYVESRMTFIAPNLSMIVGASTAAKLL
GIAGGLSKLSKMPACNVQVLGAQKKTLSGFSQTQMLPHTGYVYYSQIVQDTAPDLRRKAA
RLVAAKSVLAARVDACHESVHGEIGLRFKEDVEKKLDKLQEPPPVKFIKPLPKPIEGSKK
KRGGKRVRKMKERYALTEFRKQANRMNFGDIEEDAYQGDLGYSRGTIGKTGTGRIRLPQV
DEKTKVRISKTLHKNLQKQQVYGGNTTVKRQISGTASSVAFTPLQGLEIVNPQAAERSQT
EANAKYFSNTSGFMSVGQRTT |
| Structure Information |
| PDB ID | closest is human at 62% amino acid sequence identity |
| Quaternary structure | NA |
| SCOP | NA |
| CATH | NA |
| TM Helix Prediction | no TM helices |
| DisProt Annotation | Not in DisProt |
| Predicted Disorder Regions | NA |
| Connections to Disease |
| OMIM ID | |
| Function 1 |
| Function description | component of spliceosome |
| References for function | 10908584 |
| E.C. number | NA |
| Location of functional site(s) | NA |
| Cellular location of function | cytoplasm, spliceosome |
| Comments | NA |
| Function 2 |
| Function description | binds Ndc80, Mitch, and Nuf2 (Ndc80 complex) without it see Reduced accumulation of Ndc80 at kinetochores and severe defects in chromosome alignment |
| References for function | 30475206 |
| E.C. number | NA |
| Location of functional site(s) | NA |
| Cellular location of function | mitotic spindle |
| Comments | NA |