Protein Information

General Information
MoonProt ID510
First appeared in release3.0
Name(s)Fibroblast growth factor 1 Gene:FGF1 Synonyms:FGFA Recommended name: Fibroblast growth factor 1 Short name: FGF-1 Alternative name(s): Acidic fibroblast growth factor Short name: aFGF Endothelial cell growth factor Short name: ECGF Heparin-binding growth factor 1 Short name: HBGF-1
UniProt IDP05230 (FGF1_HUMAN)
GO termsGO:0045766 positive regulation of angiogenesis GO:0008543 fibroblast growth factor receptor signaling pathway GO:0008201 heparin binding GO:0008083 growth factor activity GO:0051781 positive regulation of cell division GO:0034605 cellular response to heat GO:0030335 positive regulation of cell migration GO:0005829 cytosol GO:0005615 extracellular space GO:0005576 extracellular region GO:0005178 integrin binding GO:0005104 fibroblast growth factor receptor binding GO:0032148 activation of protein kinase B activity GO:0008543 fibroblast growth factor receptor signaling pathway GO:0008201 heparin binding GO:1903672 positive regulation of sprouting angiogenesis GO:0000187 activation of MAPK activity GO:0030335 positive regulation of cell migration GO:0008284 positive regulation of cell population proliferation GO:1901509 regulation of endothelial tube morphogenesis GO:0010595 positive regulation of endothelial cell migration GO:0001525 angiogenesis GO:0030154 cell differentiation GO:0051781 positive regulation of cell division GO:0008083 growth factor activity GO:0007275 multicellular organism development GO:0005634 nucleus GO:0005737 cytoplasm GO:0005938 cell cortex GO:0043406 positive regulation of MAP kinase activity GO:0044548 S100 protein binding GO:2000544 regulation of endothelial cell chemotaxis to fibroblast growth factor GO:0060681 branch elongation involved in ureteric bud branching GO:0042060 wound healing GO:0072163 mesonephric epithelium development
Organisms for which functions have been demonstratedHomo sapiens (Human)
Sequence length155 amino acids
FASTA sequence>sp|P05230|FGF1_HUMAN Fibroblast growth factor 1 OS=Homo sapiens OX=9606 GN=FGF1 PE=1 SV=1 MAEGEITTFTALTEKFNLPPGNYKKPKLLYCSNGGHFLRILPDGTVDGTRDRSDQHIQLQLSAESVGEVYIKSTETGQYLAMDTDGLLYGSQTPNEECLFLERLEENHYNTYISKKHAEKNWFVGLKKNGSCKRGPRTHYGQKAILFLPLPVSSD
Structure Information
PDB ID1AXM 1DJS 1DZC 1DZD 1E0O 1EVT 1HKN 1JQZ 1JT3 1JT4 1JT5 1JT7 1JTC 1JY0 1K5U 1K5V 1M16 1NZK 1P63 1PZZ 1Q03 1Q04 1QCT 1RG8 1RML 1RY7 1YTO 1Z2V 1Z4S 2AFG 2AQZ 2AXM 2ERM 2HW9 2HWA 2HWM 2HZ9 2K43 2K4A 2K8R 2KI4 2KI6 2NTD 2Q9X 2RQ9 3B9U 3BA4 3BA5 3BA7 3BAD 3BAG 3BAH 3BAO 3BAQ 3BAU 3BAV 3BB2 3CQA 3CRG 3CRH 3CRI 3CU1 3FGM 3FJ8 3FJ9 3FJA 3FJB 3FJC 3FJD 3FJE 3FJF 3FJH 3FJI 3FJJ 3FJK 3HOM 3JUT 3K1X 3O3Q 3OJ2 3OJM 3OJV 3UD7 3UD8 3UD9 3UDA 4J23 4Q91 4Q9G 4Q9P 4QAL 4QBC 4QBV 4QC4 4QO3 4XKI 4YOL
Quaternary structureNA
SCOP1 domain. class 1000001 All beta proteins fold 2000422 beta-Trefoil superfamily 3000648 Cytokine family 4001987 Fibroblast growth factors (FGF) domain 8029860 This domain is represented by 1RG8 A:1-137 Fibroblast growth factor 1. Species Homo sapiens.
CATH2 Matching CATH Superfamilies. Superfamily: 2.60.40.10 Immunoglobulins. Superfamily: 2.80.10.50 CATH superfamily 2.80.10.50. 3 Matching CATH Domains. Domain: 1djsA01. PDB code 1djs, chain A, domain 01. Superfamily: 2.60.40.10. Domain: 1djsA02. PDB code 1djs, chain A, domain 02. Superfamily: 2.60.40.10. Domain: 1djsB00. PDB code 1djs, chain B, domain 00. Superfamily: 2.80.10.50.
TM Helix Predictionno TM helices # sp|P05230|FGF1_HUMAN Number of predicted TMHs: 0 # sp|P05230|FGF1_HUMAN Exp number of AAs in TMHs: 0.00033 # sp|P05230|FGF1_HUMAN Exp number, first 60 AAs: 0 # sp|P05230|FGF1_HUMAN Total prob of N-in: 0.11036 sp|P05230|FGF1_HUMAN TMHMM2.0 outside 1 155
DisProt Annotation
Predicted Disorder RegionsUse FASTA sequence on the MFDp2 webserver. spP05230FGF1_HUMAN_Fibro is 155 residues long, with 36 residues (23.23 %) predicted as disordered. The protein has 2 short (< 30 residues) disorder segments and 0 long (>= 30 residues) disorder segments. Segment 1 - Short (< 30 residues) disordered segment Segment is located between positions 1 and 15 in the sequence. The segment is 15 residues long (9.68 % of the total sequence length). Segment 2 - Short (< 30 residues) disordered segment Segment is located between positions 135 and 155 in the sequence. The segment is 21 residues long (13.55 % of the total sequence length).
Connections to Disease
OMIM ID131220
Function 1
Function descriptiongrowth factor
References for functionOrnitz DM, Xu J, Colvin JS, McEwen DG, MacArthur CA, Coulier F, Gao G, Goldfarb M. Receptor specificity of the fibroblast growth factor family. J Biol Chem. 1996 Jun 21;271(25):15292-7. doi: 10.1074/jbc.271.25.15292. PMID: 8663044.
E.C. number
Location of functional site(s)
Cellular location of functionsecreted
Comments
Function 2
Function descriptionnuclear anti-apoptotic factor
References for functionDelmas E, Jah N, Pirou C, Bouleau S, Le Floch N, Vayssière JL, Mignotte B, Renaud F. FGF1 C-terminal domain and phosphorylation regulate intracrine FGF1 signaling for its neurotrophic and anti-apoptotic activities. Cell Death Dis. 2016 Feb 4;7(2):e2079. doi: 10.1038/cddis.2016.2. PMID: 26844696; PMCID: PMC4849156.
E.C. number
Location of functional site(s)
Cellular location of functionnucleus
Comments