| General Information |
| MoonProt ID | 513 |
| First appeared in release | 3.0 |
| Name(s) | Malate dehydrogenase 2 |
| UniProt ID | P40296 |
| GO terms | GO:0030060 L-malate dehydrogenase activity
GO:0006099 tricarboxylic acid cycle
GO:0005739 mitochondrion
GO:0005737 cytoplasm
GO:0009060 aerobic respiration
GO:0030060 L-malate dehydrogenase activity
GO:0005975 carbohydrate metabolic process
GO:0006099 tricarboxylic acid cycle
GO:0016615 malate dehydrogenase activity
GO:0019752 carboxylic acid metabolic process
GO:0030060 L-malate dehydrogenase activity
GO:0055114 oxidation-reduction process
GO:0003824 catalytic activity
GO:0006108 malate metabolic process
GO:0016491 oxidoreductase activity
GO:0016616 oxidoreductase activity, acting on the CH-OH group of donors, NAD or NADP as acceptor
GO:0006099 tricarboxylic acid cycle
GO:0055114 oxidation-reduction process
GO:0016491 oxidoreductase activity
GO:0005739 mitochondrion
GO:0030060 L-malate dehydrogenase activity
GO:0005759 mitochondrial matrix
GO:0005759 mitochondrial matrix
GO:0006099 tricarboxylic acid cycle
GO:0006094 gluconeogenesis
GO:0016020 membrane
GO:0030060 L-malate dehydrogenase activity
GO:0046554 malate dehydrogenase (NADP+) activity
GO:0043621 protein self-association
GO:0006108 malate metabolic process
GO:0006107 oxaloacetate metabolic process
GO:0005759 mitochondrial matrix
GO:0005739 mitochondrion
GO:0030060 L-malate dehydrogenase activity
GO:0016615 malate dehydrogenase activity
GO:0006734 NADH metabolic process
GO:0006099 tricarboxylic acid cycle
GO:0005759 mitochondrial matrix
GO:0005739 mitochondrion
GO:0030060 L-malate dehydrogenase activity
GO:0006108 malate metabolic process
GO:0005739 mitochondrion
GO:0070062 extracellular exosome
GO:0070062 extracellular exosome
GO:0030060 L-malate dehydrogenase activity
GO:0070062 extracellular exosome
GO:0003723 RNA binding
GO:0003723 RNA binding
GO:0006108 malate metabolic process
GO:0005739 mitochondrion
GO:0005634 nucleus
|
| Organisms for which functions have been demonstrated | Homo sapeins (human) |
| Sequence length | 340 amimo acids |
| FASTA sequence | >sp|P40926|MDHM_HUMAN Malate dehydrogenase, mitochondrial OS=Homo sapiens OX=9606 GN=MDH2 PE=1 SV=3
MLSALARPASAALRRSFSTSAQNNAKVAVLGASGGIGQPLSLLLKNSPLVSRLTLYDIAH
TPGVAADLSHIETKAAVKGYLGPEQLPDCLKGCDVVVIPAGVPRKPGMTRDDLFNTNATI
VATLTAACAQHCPEAMICVIANPVNSTIPITAEVFKKHGVYNPNKIFGVTTLDIVRANTF
VAELKGLDPARVNVPVIGGHAGKTIIPLISQCTPKVDFPQDQLTALTGRIQEAGTEVVKA
KAGAGSATLSMAYAGARFVFSLVDAMNGKEGVVECSFVKSQETECTYFSTPLLLGKKGIE
KNLGIGKVSSFEEKMISDAIPELKASIKKGEDFVKTLK |
| Structure Information |
| PDB ID | 4WLE |
| Quaternary structure | n/a |
| SCOP | n/a |
| CATH | n/a |
| TM Helix Prediction | n/a |
| DisProt Annotation | n/a |
| Predicted Disorder Regions | Predicted disorder at N terminus (aa 1-4), middle region (aa 228), and C terminus (aa 305-307) |
| Connections to Disease |
| OMIM ID | n/a |
| Function 1 |
| Function description | malate dehydrogenase, enzyme |
| References for function | n/a |
| E.C. number | 1.1.1.37 |
| Location of functional site(s) | n/a |
| Cellular location of function | mitochondrial matrix |
| Comments | n/a |
| Function 2 |
| Function description | mRNA binding |
| References for function | n/a |
| E.C. number | n/a |
| Location of functional site(s) | n/a |
| Cellular location of function | n/a |
| Comments | n/a |