| General Information |
| MoonProt ID | 533 |
| First appeared in release | 4.0 |
| Name(s) | Candida parapsilosis (strain CDC 317 / ATCC MYA-4646) (Yeast) (Monilia parapsilosis) |
| UniProt ID | G8BE40 |
| GO terms | "GO:0003824 catalytic activity
GO:0004619 phosphoglycerate mutase activity
GO:0016853 isomerase activity
GO:0016868 intramolecular phosphotransferase activity
GO:0006094 gluconeogenesis
GO:0006096 glycolytic process
GO:0005739 mitochondrion
GO:0005758 mitochondrial intermembrane space
GO:0005829 cytosol
GO:0009986 cell surface" |
| Organisms for which functions have been demonstrated | Candida parapsilosis (strain CDC 317 / ATCC MYA-4646) (Yeast) (Monilia parapsilosis) |
| Sequence length | _ |
| FASTA sequence | ">tr|G8BE40|G8BE40_CANPC Phosphoglycerate mutase OS=Candida parapsilosis (strain CDC 317 / ATCC MYA-4646) OX=578454 GN=CPAR2_211810 PE=3 SV=1
MPKLVLIRHGQSDWNEKNLFTGWVDVKLSETGRKEAKRAGELIKEAGIKGDVLHTSLLSR
AIQTADIALEEADQLWLPVKRSWRLNERHYGDLQGKDKAETLEQYGKEKFQTWRRSFDVP
PPPISADNKYSQVGERRYADLDPSVVPHTESLKLVIDRLIPYWQDEIAADLLDGKVVIVA
AHGNSLRALVKHLDNISDEEIAGLNIPTGIPLVYELDEKLKPTKPAYYLDPEAAAAGAAA
VAAQGTKK" |
| Structure Information |
| PDB ID | NA |
| Quaternary structure | NA |
| SCOP | |
| CATH | |
| TM Helix Prediction | no TM helices |
| DisProt Annotation | |
| Predicted Disorder Regions | |
| Connections to Disease |
| OMIM ID | |
| Function 1 |
| Function description | enzyme, Phosphoglycerate mutase, converts 1,3-bisphosphoglycerate <=> 2,3-bisphosphoglycerate |
| References for function | Kozik A, Karkowska-Kuleta J, Zajac D, Bochenska O, Kedracka-Krok S, Jankowska U, Rapala-Kozik M. Fibronectin-, vitronectin- and laminin-binding proteins at the cell walls of Candida parapsilosis and Candida tropicalis pathogenic yeasts. BMC Microbiol. 2015 Oct 5;15:197. doi: 10.1186/s12866-015-0531-4. PMID: 26438063; PMCID: PMC4595241. |
| E.C. number | EC:5.4.2.11 |
| Location of functional site(s) | |
| Cellular location of function | cytoplasm |
| Comments | |
| Function 2 |
| Function description | binds fibronectin, binds vitronectin, binds laminin |
| References for function | Kozik A, Karkowska-Kuleta J, Zajac D, Bochenska O, Kedracka-Krok S, Jankowska U, Rapala-Kozik M. Fibronectin-, vitronectin- and laminin-binding proteins at the cell walls of Candida parapsilosis and Candida tropicalis pathogenic yeasts. BMC Microbiol. 2015 Oct 5;15:197. doi: 10.1186/s12866-015-0531-4. PMID: 26438063; PMCID: PMC4595241. |
| E.C. number | |
| Location of functional site(s) | |
| Cellular location of function | |
| Comments | |