| General Information |
| MoonProt ID | 539 |
| First appeared in release | 4.0 |
| Name(s) | Trachemys scripta (Red-eared slider turtle) (Pseudemys scripta) |
| UniProt ID | Q9W6D2 |
| GO terms | GO:0000287 magnesium ion binding, GO:0004634 phosphopyruvate hydratase activity, GO:0016829 lyase activity, GO:0046872 metal ion binding, GO:0006096 glycolytic process, GO:0005737 cytoplasm, GO:0000015 phosphopyruvate hydratase complex |
| Organisms for which functions have been demonstrated | Trachemys scripta (Red-eared slider turtle) (Pseudemys scripta) |
| Sequence length | 373.0 |
| FASTA sequence | ">tr|Q9W6D2|Q9W6D2_TRASC phosphopyruvate hydratase (Fragment) OS=Trachemys scripta OX=34903 PE=2 SV=1
VEVDLYTSKGLFRAAVPSGASTGIYEALELRDNDKTRFLGKGVSKAVGHVNKTIAPALIS
KNINVVEQEKIDKLMLEMDGSENKSKFGANAILGVSLAVCKAGAAEKGVPLYRHIADLAG
NPEVILPVPAFNVINGGSHAGNKLAMQEFMILPVGAESFKEAMRIGAEVYHNLKNVIKEK
YGKDATNVGDEGGFAPNILENKEALELLKTAISKAGYTDKVVIGMDVAASEFYRDGKYDL
DFKSPDDPSRYITPDQLADLYKSFIKSYPLVSIEDPFDQDDWSAWKKFTASVGVQVVGDD
LTVTNPKRIAKAVEEKSCNCLLLKVNQIGSVTESLQACKLAQSNGWGVMVSHRSGETEDT
FIADLVVGLCTGQ" |
| Structure Information |
| PDB ID | NA |
| Quaternary structure | NA |
| SCOP | |
| CATH | |
| TM Helix Prediction | no TM helices |
| DisProt Annotation | |
| Predicted Disorder Regions | |
| Connections to Disease |
| OMIM ID | |
| Function 1 |
| Function description | enzyme, enolase, 2-phospho-D-glycerate => phosphoenolpyruvate + H2O Catalyzes the reversible conversion of 2-phosphoglycerate into phosphoenolpyruvate. Carbohydrate degradation, glycolysis |
| References for function | Williams 1985 AND GJ, Lietman T, Williams LA, Stapel SO, de Jong WW, Horwitz J, Piatigorsky J. Tau-crystallin/alpha-enolase: one gene encodes both an enzyme and a lens structural protein. J Cell Biol. 1988 Dec;107(6 Pt 2):2729-36. doi: 10.1083/jcb.107.6.2729. PMID: 2462567; PMCID: PMC2115652. |
| E.C. number | EC:4.2.1.11 |
| Location of functional site(s) | |
| Cellular location of function | cytoplasm |
| Comments | |
| Function 2 |
| Function description | tau-crystallin |
| References for function | Williams 1985 AND GJ, Lietman T, Williams LA, Stapel SO, de Jong WW, Horwitz J, Piatigorsky J. Tau-crystallin/alpha-enolase: one gene encodes both an enzyme and a lens structural protein. J Cell Biol. 1988 Dec;107(6 Pt 2):2729-36. doi: 10.1083/jcb.107.6.2729. PMID: 2462567; PMCID: PMC2115652. |
| E.C. number | |
| Location of functional site(s) | |
| Cellular location of function | lens of the eye |
| Comments | |