| General Information |
| MoonProt ID | 540 |
| First appeared in release | 4.0 |
| Name(s) | Rattus norvegicus (Rat) |
| UniProt ID | P05708 |
| GO terms | GO:0000166 nucleotide binding, GO:0003824 catalytic activity, GO:0004340 glucokinase activity, GO:0004396 hexokinase activity, GO:0004672 protein kinase activity, GO:0005515 protein binding, GO:0005524 ATP binding, GO:0005536 D-glucose binding, GO:0008865 fructokinase activity, GO:0016301 kinase activity, GO:0016740 transferase activity, GO:0016773 phosphotransferase activity, alcohol group as acceptor, GO:0016887 ATP hydrolysis activity, GO:0019158 mannokinase activity, GO:0042802 identical protein binding, GO:0042834 peptidoglycan binding, GO:0044877 protein-containing complex binding, GO:0047931 glucosamine kinase activity, GO:0001666 response to hypoxia, GO:0001678 intracellular glucose homeostasis, GO:0002376 immune system process, GO:0002720 positive regulation of cytokine production involved in immune response, GO:0002931 response to ischemia, GO:0005975 carbohydrate metabolic process, GO:0006002 fructose 6-phosphate metabolic process, GO:0006006 glucose metabolic process, GO:0006013 mannose metabolic process, GO:0006096 glycolytic process, GO:0006954 inflammatory response, GO:0009741 response to brassinosteroid, GO:0019318 hexose metabolic process, GO:0032731 positive regulation of interleukin-1 beta production, GO:0043066 negative regulation of apoptotic process, GO:0045087 innate immune response, GO:0046835 carbohydrate phosphorylation, GO:0051156 glucose 6-phosphate metabolic process, GO:0061621 canonical glycolysis, GO:0061728 GDP-mannose biosynthetic process from mannose, GO:0072655 establishment of protein localization to mitochondrion, GO:0072656 maintenance of protein location in mitochondrion, GO:1901986 response to ketamine, GO:0005739 mitochondrion, GO:0005829 cytosol, GO:0005741 mitochondrial outer membrane, GO:0005901 caveola, GO:0005929 cilium, GO:0045121 membrane raft, GO:0097228 sperm principal piece, GO:0032991 protein-containing complex |
| Organisms for which functions have been demonstrated | Rattus norvegicus (Rat) |
| Sequence length | 918.0 |
| FASTA sequence | ">sp|P05708|HXK1_RAT Hexokinase-1 OS=Rattus norvegicus OX=10116 GN=Hk1 PE=1 SV=4
MIAAQLLAYYFTELKDDQVKKIDKYLYAMRLSDEILIDILTRFKKEMKNGLSRDYNPTAS
VKMLPTFVRSIPDGSEKGDFIALDLGGSSFRILRVQVNHEKNQNVSMESEIYDTPENIVH
GSGTQLFDHVADCLGDFMEKKKIKDKKLPVGFTFSFPCRQSKIDEAVLITWTKRFKASGV
EGADVVKLLNKAIKKRGDYDANIVAVVNDTVGTMMTCGYDDQQCEVGLIIGTGTNACYME
ELRHIDLVEGDEGRMCINTEWGAFGDDGSLEDIRTEFDRELDRGSLNPGKQLFEKMVSGM
YMGELVRLILVKMAKEGLLFEGRITPELLTRGKFNTSDVSAIEKDKEGIQNAKEILTRLG
VEPSDVDCVSVQHICTIVSFRSANLVAATLGAILNRLRDNKGTPRLRTTVGVDGSLYKMH
PQYSRRFHKTLRRLVPDSDVRFLLSESGTGKGAAMVTAVAYRLAEQHRQIEETLAHFRLS
KQTLMEVKKRLRTEMEMGLRKETNSKATVKMLPSFVRSIPDGTEHGDFLALDLGGTNFRV
LLVKIRSGKKRTVEMHNKIYSIPLEIMQGTGDELFDHIVSCISDFLDYMGIKGPRMPLGF
TFSFPCHQTNLDCGILISWTKGFKATDCEGHDVASLLRDAVKRREEFDLDVVAVVNDTVG
TMMTCAYEEPTCEIGLIVGTGTNACYMEEMKNVEMVEGNQGQMCINMEWGAFGDNGCLDD
IRTDFDKVVDEYSLNSGKQRFEKMISGMYLGEIVRNILIDFTKKGFLFRGQISEPLKTRG
IFETKFLSQIESDRLALLQVRAILQQLGLNSTCDDSILVKTVCGVVSKRAAQLCGAGMAA
VVEKIRENRGLDHLNVTVGVDGTLYKLHPHFSRIMHQTVKELSPKCTVSFLLSEDGSGKG
AALITAVGVRLRGDPSIA" |
| Structure Information |
| PDB ID | 1BG3 |
| Quaternary structure | NA |
| SCOP | "80321211BG3 A:1-465
80321231BG3 A:466-911
80444991BG3 A:1-222
80445001BG3 A:223-465
80445011BG3 A:466-670
80445021BG3 A:671-911" |
| CATH | 1bg3A01, 1bg3A02, 1bg3A03, 1bg3A04, 1bg3B01, 1bg3B02, 1bg3B03, 1bg3B04 |
| TM Helix Prediction | no TM helices |
| DisProt Annotation | |
| Predicted Disorder Regions | |
| Connections to Disease |
| OMIM ID | |
| Function 1 |
| Function description | enzyme, hexokinase 1, phosphorylates glucose in glycolysis |
| References for function | Azoulay-Zohar H, Israelson A, Abu-Hamad S, Shoshan-Barmatz V. In self-defence: hexokinase promotes voltage-dependent anion channel closure and prevents mitochondria-mediated apoptotic cell death. Biochem J. 2004 Jan 15;377(Pt 2):347-55. doi: 10.1042/BJ20031465. PMID: 14561215; PMCID: PMC1223882. |
| E.C. number | EC:2.7.1.1 |
| Location of functional site(s) | |
| Cellular location of function | cytoplasm |
| Comments | |
| Function 2 |
| Function description | binds to VDAC voltage-dependent anion channel and induces channel closure |
| References for function | Azoulay-Zohar H, Israelson A, Abu-Hamad S, Shoshan-Barmatz V. In self-defence: hexokinase promotes voltage-dependent anion channel closure and prevents mitochondria-mediated apoptotic cell death. Biochem J. 2004 Jan 15;377(Pt 2):347-55. doi: 10.1042/BJ20031465. PMID: 14561215; PMCID: PMC1223882. |
| E.C. number | |
| Location of functional site(s) | |
| Cellular location of function | |
| Comments | |