| General Information |
| MoonProt ID | 541 |
| First appeared in release | 4.0 |
| Name(s) | Schistosoma bovis (blood fluke) |
| UniProt ID | B2LXU1 |
| GO terms | GO:0000287 magnesium ion binding, GO:0004634 phosphopyruvate hydratase activity, GO:0016829 lyase activity, GO:0046872 metal ion binding, GO:0006096 glycolytic process, GO:0000015 phosphopyruvate hydratase complex |
| Organisms for which functions have been demonstrated | Schistosoma bovis (blood fluke) |
| Sequence length | 434.0 |
| FASTA sequence | ">tr|B2LXU1|B2LXU1_SCHBO Enolase OS=Schistosoma bovis OX=6184 PE=2 SV=1
MSIIAIHARQIFDSRGNPTVEVDLKTSKGLFRAAVPSGASTGVHEALELRDTKSKAYMGK
GVLTAVSNVNTIIAPALIQKNIPVTDQAAIDRFMIELDGTENKEKLGANAILGVSLAVCK
AGAAEAGLPLYRYIAKLAGHENVIMPVPAFNVINGGSHAGNKLAMQEFMILPTGASSFTE
AMKIGSEVYHNLKAVIKREYGLDACNVGDEGGFAPNIQDNMKGLQLLEEAIKIAGYTGKK
EIGMDCAASEFHKNGKYDLDFKNPHSAESAWLSPDAMTNVYKEMISKYPIVSIEDPVDQD
DWETWPKLTASTNIQIVGDDLTVTNPKRIKKAISSKACNCLLLKVNQIGSLTESIEACKL
AQNAGWGVMVSHRSGETEDTFIADLVVGLCTGQIKAGAPCRSDRLAKYNQLLRIEEELGA
AAKYAGKNFRHPKK" |
| Structure Information |
| PDB ID | NA |
| Quaternary structure | NA |
| SCOP | |
| CATH | |
| TM Helix Prediction | no TM helices |
| DisProt Annotation | |
| Predicted Disorder Regions | |
| Connections to Disease |
| OMIM ID | |
| Function 1 |
| Function description | enzyme, enolase, 2-phospho-D-glycerate => phosphoenolpyruvate + H2O Catalyzes the reversible conversion of 2-phosphoglycerate into phosphoenolpyruvate. Carbohydrate degradation, glycolysis |
| References for function | de la Torre-Escudero E, Manzano-Román R, Pérez-Sánchez R, Siles-Lucas M, Oleaga A. Cloning and characterization of a plasminogen-binding surface-associated enolase from Schistosoma bovis. Vet Parasitol. 2010 Oct 11;173(1-2):76-84. doi: 10.1016/j.vetpar.2010.06.011. Epub 2010 Jun 15. PMID: 20609522. |
| E.C. number | EC:4.2.1.11 |
| Location of functional site(s) | |
| Cellular location of function | cytoplasm |
| Comments | |
| Function 2 |
| Function description | binds to plasminogen and aids its activation to plasmin in the presence of tissue plasminogen activator (tPA) |
| References for function | de la Torre-Escudero E, Manzano-Román R, Pérez-Sánchez R, Siles-Lucas M, Oleaga A. Cloning and characterization of a plasminogen-binding surface-associated enolase from Schistosoma bovis. Vet Parasitol. 2010 Oct 11;173(1-2):76-84. doi: 10.1016/j.vetpar.2010.06.011. Epub 2010 Jun 15. PMID: 20609522. |
| E.C. number | |
| Location of functional site(s) | |
| Cellular location of function | |
| Comments | |