| General Information |
| MoonProt ID | 562 |
| First appeared in release | 4.0 |
| Name(s) | Mortality factor 4-like protein 1 |
| UniProt ID | Q9UBU8 |
| GO terms | "GO:0008283 cell population proliferation
GO:0003682 chromatin binding
GO:0005515 protein binding
GO:0005515 protein binding
GO:0005515 protein binding
GO:0005515 protein binding
GO:0005515 protein binding
GO:0005515 protein binding
GO:0005515 protein binding
GO:0005515 protein binding
GO:0005515 protein binding
GO:0005515 protein binding
GO:0005515 protein binding
GO:0005515 protein binding
GO:0005515 protein binding
GO:0005515 protein binding
GO:0005515 protein binding
GO:0005515 protein binding
GO:0005515 protein binding
GO:0005515 protein binding
GO:0005515 protein binding
GO:0005515 protein binding
GO:0005515 protein binding
GO:0005515 protein binding
GO:0005515 protein binding
GO:0005515 protein binding
GO:0005515 protein binding
GO:0005515 protein binding
GO:0005515 protein binding
GO:0005515 protein binding
GO:0005515 protein binding
GO:0005515 protein binding
GO:0005515 protein binding
GO:0005515 protein binding
GO:0005515 protein binding
GO:0005515 protein binding
GO:0005515 protein binding
GO:0005515 protein binding
GO:0005515 protein binding
GO:0005515 protein binding
GO:0005515 protein binding
GO:0005515 protein binding
GO:0005515 protein binding
GO:0005515 protein binding
GO:0005515 protein binding
GO:0005515 protein binding
GO:0005515 protein binding
GO:0005515 protein binding
GO:0005515 protein binding
GO:0005515 protein binding
GO:0000724 double-strand break repair via homologous recombination
GO:0006281 DNA repair
GO:0006310 DNA recombination
GO:0006325 chromatin organization
GO:0006355 regulation of DNA-templated transcription
GO:0006974 DNA damage response
GO:0042981 regulation of apoptotic process
GO:0045893 positive regulation of DNA-templated transcription
GO:0051726 regulation of cell cycle
GO:1905168 positive regulation of double-strand break repair via homologous recombination
GO:1905168 positive regulation of double-strand break repair via homologous recombination
GO:2000779 regulation of double-strand break repair
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0016607 nuclear speck
GO:0000786 nucleosome
GO:0000786 cellular_component nucleosome
GO:0035267 NuA4 histone acetyltransferase complex
GO:0035267 NuA4 histone acetyltransferase complex
GO:0035267 NuA4 histone acetyltransferase complex
GO:0035267 NuA4 histone acetyltransferase complex
GO:0070822 Sin3-type complex" |
| Organisms for which functions have been demonstrated | Homo sapiens (Human) |
| Sequence length | 362.0 |
| FASTA sequence | >sp|Q9UBU8|MO4L1_HUMAN Mortality factor 4-like protein 1 OS=Homo sapiens OX=9606 GN=MORF4L1 PE=1 SV=2 MAPKQDPKPKFQEGERVLCFHGPLLYEAKCVKVAIKDKQVKYFIHYSGWNKKSAVRPRRS EKSLKTHEDIVALFPVPEGAPSVHHPLLTSSWDEWVPESRVLKYVDTNLQKQRELQKANQ EQYAEGKMRGAAPGKKTSGLQQKNVEVKTKKNKQKTPGNGDGGSTSETPQPPRKKRARVD PTVENEETFMNRVEVKVKIPEELKPWLVDDWDLITRQKQLFYLPAKKNVDSILEDYANYK KSRGNTDNKEYAVNEVVAGIKEYFNVMLGTQLLYKFERPQYAEILADHPDAPMSQVYGAP HLLRLFVRIGAMLAYTPLDEKSLALLLNYLHDFLKYLAKNSATLFSASDYEVAPPEYHRK AV |
| Structure Information |
| PDB ID | 2AQL |
| Quaternary structure | part of a multiprotein complex |
| SCOP | "No SCOP2 classification is available for 2AQL A explicitly. This entry is represented by following domains ...
80474982LKM B
80927752LKM B
No SCOP2 classification is available for 2AQL B explicitly. This entry is represented by following domains ...
80474982LKM B
80927752LKM B" |
| CATH | 1.10.274.30 |
| TM Helix Prediction | no TM helices |
| DisProt Annotation | |
| Predicted Disorder Regions | Predicted disorder at N terminus (aa 1-9), middle region (aa 115-184), and C terminus (aa 357-362) |
| Connections to Disease |
| OMIM ID | |
| Function 1 |
| Function description | Component of p400/Tip60 chromatin remodeling complex |
| References for function | _ |
| E.C. number | |
| Location of functional site(s) | |
| Cellular location of function | nucleus |
| Comments | |
| Function 2 |
| Function description | localizes to midbody during cell division |
| References for function | Messina G, Prozzillo Y, Monache FD, Santopietro MV, Dimitri P. Evolutionary conserved relocation of chromatin remodeling complexes to the mitotic apparatus. BMC Biol. 2022 Aug 3;20(1):172. doi: 10.1186/s12915-022-01365-5. PMID: 35922843; PMCID: PMC9351137. |
| E.C. number | |
| Location of functional site(s) | |
| Cellular location of function | localizes to midbody during cell division |
| Comments | |