| General Information |
| MoonProt ID | 567 |
| First appeared in release | 4.0 |
| Name(s) | NUP93 |
| UniProt ID | Q8N1F7 |
| GO terms | "GO:0005515 protein binding
GO:0017056 structural constituent of nuclear pore
GO:0006606 protein import into nucleus
GO:0006913 nucleocytoplasmic transport
GO:0006998 nuclear envelope organization
GO:0015031 protein transport
GO:0016973 poly(A)+ mRNA export from nucleus
GO:0051028 mRNA transport
GO:0051292 nuclear pore complex assembly
GO:0060391 positive regulation of SMAD protein signal transduction
GO:0005635 nuclear envelope
GO:0005813 centrosome
GO:0005829 cytosol
GO:0016020 membrane
GO:0031965 nuclear membrane
GO:0034399 nuclear periphery
GO:0005643 nuclear pore" |
| Organisms for which functions have been demonstrated | Homo sapiens (Human) |
| Sequence length | 819 |
| FASTA sequence | >sp|Q8N1F7|NUP93_HUMAN Nuclear pore complex protein Nup93 OS=Homo sapiens OX=9606 GN=NUP93 PE=1 SV=2
MDTEGFGELLQQAEQLAAETEGISELPHVERNLQEIQQAGERLRSRTLTRTSQETADVKA
SVLLGSRGLDISHISQRLESLSAATTFEPLEPVKDTDIQGFLKNEKDNALLSAIEESRKR
TFGMAEEYHRESMLVEWEQVKQRILHTLLASGEDALDFTQESEPSYISDVGPPGRSSLDN
IEMAYARQIYIYNEKIVNGHLQPNLVDLCASVAELDDKSISDMWTMVKQMTDVLLTPATD
ALKNRSSVEVRMEFVRQALAYLEQSYKNYTLVTVFGNLHQAQLGGVPGTYQLVRSFLNIK
LPAPLPGLQDGEVEGHPVWALIYYCMRCGDLLAASQVVNRAQHQLGEFKTWFQEYMNSKD
RRLSPATENKLRLHYRRALRNNTDPYKRAVYCIIGRCDVTDNQSEVADKTEDYLWLKLNQ
VCFDDDGTSSPQDRLTLSQFQKQLLEDYGESHFTVNQQPFLYFQVLFLTAQFEAAVAFLF
RMERLRCHAVHVALVLFELKLLLKSSGQSAQLLSHEPGDPPCLRRLNFVRLLMLYTRKFE
STDPREALQYFYFLRDEKDSQGENMFLRCVSELVIESREFDMILGKLENDGSRKPGVIDK
FTSDTKPIINKVASVAENKGLFEEAAKLYDLAKNADKVLELMNKLLSPVVPQISAPQSNK
ERLKNMALSIAERYRAQGISANKFVDSTFYLLLDLITFFDEYHSGHIDRAFDIIERLKLV
PLNQESVEERVAAFRNFSDEIRHNLSEVLLATMNILFTQFKRLKGTSPSSSSRPQRVIED
RDSQLRSQARTLITFAGMIPYRTSGDTNARLVQMEVLMN |
| Structure Information |
| PDB ID | 5IJN |
| Quaternary structure | part of the nuclear pore complex |
| SCOP | 80453455IJN C:173-815
80467645IJN H:334-502
80532685IJN H:334-502
80903135IJN C:408-815A |
| CATH | NA |
| TM Helix Prediction | no TM helices |
| DisProt Annotation | not in DisProt |
| Predicted Disorder Regions | Predicted disorder at N terminus (aa 1-15), middle region (aa 18-34, 43-49, 163-171, 766-783), and C terminus (aa 814-819) |
| Connections to Disease |
| OMIM ID | |
| Function 1 |
| Function description | component of nuclear pore |
| References for function | Kee, H., Dishinger, J., Lynne Blasius, T. et al. A size-exclusion permeability barrier and nucleoporins characterize a ciliary pore complex that regulates transport into cilia. Nat Cell Biol 14, 431–437 (2012). https://doi.org/10.1038/ncb2450 |
| E.C. number | |
| Location of functional site(s) | |
| Cellular location of function | nuclear membrane |
| Comments | |
| Function 2 |
| Function description | component of base of primary cilia |
| References for function | Kee, H., Dishinger, J., Lynne Blasius, T. et al. A size-exclusion permeability barrier and nucleoporins characterize a ciliary pore complex that regulates transport into cilia. Nat Cell Biol 14, 431–437 (2012). https://doi.org/10.1038/ncb2450 |
| E.C. number | |
| Location of functional site(s) | |
| Cellular location of function | base of primary cilia |
| Comments | |