| General Information |
| MoonProt ID | 568 |
| First appeared in release | 4.0 |
| Name(s) | NUP37 |
| UniProt ID | Q8NFH4 |
| GO terms | "GO:0000776 kinetochore
GO:0005515 protein binding
GO:0006913 nucleocytoplasmic transport
GO:0007059 chromosome segregation
GO:0015031 protein transport
GO:0051028 mRNA transport
GO:0051301 cell division
GO:0000776 kinetochore
GO:0005634 nucleus
GO:0005635 nuclear envelope
GO:0005654 nucleoplasm
GO:0005829 cytosol
GO:0005643 nuclear pore
GO:0031080 nuclear pore outer ring
" |
| Organisms for which functions have been demonstrated | Homo sapiens (Human) |
| Sequence length | 326.0 |
| FASTA sequence | >sp|Q8NFH4|NUP37_HUMAN Nucleoporin Nup37 OS=Homo sapiens OX=9606 GN=NUP37 PE=1 SV=1
MKQDASRNAAYTVDCEDYVHVVEFNPFENGDSGNLIAYGGNNYVVIGTCTFQEEEADVEG
IQYKTLRTFHHGVRVDGIAWSPETRLDSLPPVIKFCTSAADMKIRLFTSDLQDKNEYKVL
EGHTDFINGLVFDPKEGQEIASVSDDHTCRIWNLEGVQTAHFVLHSPGMSVCWHPEETFK
LMVAEKNGTIRFYDLLAQQAILSLESEQVPLMSAHWCLKNTFKVGAVAGNDWLIWDITRS
SYPQNKRPVHMDRACLFRWSTISENLFATTGYPGKMASQFQIHHLGHPQPILMGSVAVGS
GLSWHRTLPLCVIGGDHKLLFWVTEV |
| Structure Information |
| PDB ID | 7PEQ 7R5J 7R5K |
| Quaternary structure | Component of the Nup107-160 subcomplex of the nuclear pore complex (NPC). |
| SCOP | NA |
| CATH | NA |
| TM Helix Prediction | no TM helices |
| DisProt Annotation | not in DisProt |
| Predicted Disorder Regions | Predicted disorder at N terminus (aa 1-7), and C terminus (aa 325-326) |
| Connections to Disease |
| OMIM ID | |
| Function 1 |
| Function description | component of nuclear pore |
| References for function | Kee, H., Dishinger, J., Lynne Blasius, T. et al. A size-exclusion permeability barrier and nucleoporins characterize a ciliary pore complex that regulates transport into cilia. Nat Cell Biol 14, 431–437 (2012). https://doi.org/10.1038/ncb2450 |
| E.C. number | |
| Location of functional site(s) | |
| Cellular location of function | nuclear membrane |
| Comments | |
| Function 2 |
| Function description | component of base of primary cilia |
| References for function | Kee, H., Dishinger, J., Lynne Blasius, T. et al. A size-exclusion permeability barrier and nucleoporins characterize a ciliary pore complex that regulates transport into cilia. Nat Cell Biol 14, 431–437 (2012). https://doi.org/10.1038/ncb2450 |
| E.C. number | |
| Location of functional site(s) | |
| Cellular location of function | base of primary cilia |
| Comments | |