| General Information |
| MoonProt ID | 569 |
| First appeared in release | 4.0 |
| Name(s) | NUP35 |
| UniProt ID | Q8NFH5 |
| GO terms | GO:0003676 nucleic acid binding
GO:0005515 protein binding
GO:0005543 phospholipid binding
GO:0017056 structural constituent of nuclear pore
GO:0042802 identical protein binding
GO:0006607 NLS-bearing protein import into nucleus
GO:0006913 nucleocytoplasmic transport
GO:0006999 nuclear pore organization
GO:0015031 protein transport
GO:0051028 mRNA transport
GO:0005635 nuclear envelope
GO:0005829 cytosol
GO:0031965 nuclear membrane
GO:0005643 nuclear pore
GO:0044613 nuclear pore central transport channel
GO:0044615 nuclear pore nuclear basket |
| Organisms for which functions have been demonstrated | Homo sapiens (Human) |
| Sequence length | 326 |
| FASTA sequence | >sp|Q8NFH5|NUP35_HUMAN Nucleoporin NUP35 OS=Homo sapiens OX=9606 GN=NUP35 PE=1 SV=1
MAAFAVEPQGPALGSEPMMLGSPTSPKPGVNAQFLPGFLMGDLPAPVTPQPRSISGPSVG
VMEMRSPLLAGGSPPQPVVPAHKDKSGAPPVRSIYDDISSPGLGSTPLTSRRQPNISVMQ
SPLVGVTSTPGTGQSMFSPASIGQPRKTTLSPAQLDPFYTQGDSLTSEDHLDDSWVTVFG
FPQASASYILLQFAQYGNILKHVMSNTGNWMHIRYQSKLQARKALSKDGRIFGESIMIGV
KPCIDKSVMESSDRCALSSPSLAFTPPIKTLGTPTQPGSTPRISTMRPLATAYKASTSDY
QVISDRQTPKKDESLVSKAMEYMFGW |
| Structure Information |
| PDB ID | 4LIR 7MW1 7R5J 7R5K 8OZB |
| Quaternary structure | component of the nuclear pore |
| SCOP | 80873894LIR B:169-252
80873904LIR B:169-252 |
| CATH | NA |
| TM Helix Prediction | no TM helices |
| DisProt Annotation | not in DisProt |
| Predicted Disorder Regions | Predicted disorder at N terminus (aa 1-33), middle region (aa 44-162, 266-290, 302-307), and C terminus (aa 322-326) |
| Connections to Disease |
| OMIM ID | |
| Function 1 |
| Function description | component of nuclear pore |
| References for function | Kee, H., Dishinger, J., Lynne Blasius, T. et al. A size-exclusion permeability barrier and nucleoporins characterize a ciliary pore complex that regulates transport into cilia. Nat Cell Biol 14, 431–437 (2012). https://doi.org/10.1038/ncb2450 |
| E.C. number | |
| Location of functional site(s) | |
| Cellular location of function | nuclear membrane |
| Comments | |
| Function 2 |
| Function description | component of base of primary cilia |
| References for function | Kee, H., Dishinger, J., Lynne Blasius, T. et al. A size-exclusion permeability barrier and nucleoporins characterize a ciliary pore complex that regulates transport into cilia. Nat Cell Biol 14, 431–437 (2012). https://doi.org/10.1038/ncb2450 |
| E.C. number | |
| Location of functional site(s) | |
| Cellular location of function | base of primary cilia |
| Comments | |