| General Information |
| MoonProt ID | 573 |
| First appeared in release | 4.0 |
| Name(s) | Elongation factor Tu - tuf |
| UniProt ID | C1CLI6 |
| GO terms | GO:0000166 nucleotide binding, GO:0000287 magnesium ion binding, GO:0003746 translation elongation factor activity, GO:0003924 GTPase activity, GO:0005525 GTP binding, GO:0016787 hydrolase activity, GO:0046872 metal ion binding, GO:0006412 translation, GO:0006414 translational elongation, GO:0005737 cytoplasm, GO:0005829 cytosol |
| Organisms for which functions have been demonstrated | Streptococcus pneumoniae (strain P1031). Gram positive bacterium |
| Sequence length | 398.0 |
| FASTA sequence | >sp|C1CLI6|EFTU_STRZP Elongation factor Tu OS=Streptococcus pneumoniae (strain P1031) OX=488223 GN=tuf PE=3 SV=1
MAKEKYDRSKPHVNIGTIGHVDHGKTTLTAAITTVLARRLPSSVNQPKDYASIDAAPEER
ERGITINTAHVEYETEKRHYAHIDAPGHADYVKNMITGAAQMDGAILVVASTDGPMPQTR
EHILLSRQVGVKHLIVFMNKVDLVDDEELLELVEMEIRDLLSEYDFPGDDLPVIQGSALK
ALEGDSKYEDIVMELMNTVDEYIPEPERDTDKPLLLPVEDVFSITGRGTVASGRIDRGIV
KVNDEIEIVGIKEETQKAVVTGVEMFRKQLDEGLAGDNVGVLLRGVQRDEIERGQVIAKP
GSINPHTKFKGEVYILTKEEGGRHTPFFNNYRPQFYFRTTDVTGSIELPAGTEMVMPGDN
VTIDVELIHPIAVEQGTTFSIREGGRTVGSGMVTEIEA |
| Structure Information |
| PDB ID | NA |
| Quaternary structure | NA |
| SCOP | NA |
| CATH | NA |
| TM Helix Prediction | no TM helices |
| DisProt Annotation | not in DisProt |
| Predicted Disorder Regions | N-terminus AA 1-10, 49-56, 64-69, 299, 390-398 |
| Connections to Disease |
| OMIM ID | |
| Function 1 |
| Function description | elongation factor tuf |
| References for function | Mohan, S., Hertweck, C., Dudda, A., Hammerschmidt, S., Skerka, C., Hallström, T., & Zipfel, P. F. (2014). Tuf of Streptococcus pneumoniae is a surface displayed human complement regulator binding protein. Molecular immunology, 62(1), 249–264. https://doi.org/10.1016/j.molimm.2014.06.029 |
| E.C. number | EC:3.6.5.3 |
| Location of functional site(s) | |
| Cellular location of function | cytoplasm |
| Comments | |
| Function 2 |
| Function description | binds plasminogen, binds host complement inhibitors Factor H, FHL-1, CFHR1 |
| References for function | Mohan, S., Hertweck, C., Dudda, A., Hammerschmidt, S., Skerka, C., Hallström, T., & Zipfel, P. F. (2014). Tuf of Streptococcus pneumoniae is a surface displayed human complement regulator binding protein. Molecular immunology, 62(1), 249–264. https://doi.org/10.1016/j.molimm.2014.06.029 |
| E.C. number | |
| Location of functional site(s) | |
| Cellular location of function | cell surface |
| Comments | |