| General Information |
| MoonProt ID | 582 |
| First appeared in release | 4.0 |
| Name(s) | Enolase |
| UniProt ID | B5XV19 |
| GO terms | GO:0000015 phosphopyruvate hydratase complex, GO:0000287 magnesium ion binding, GO:0004634 phosphopyruvate hydratase activity, GO:0016829 lyase activity, GO:0046872 metal ion binding, GO:0006096 glycolytic process, GO:0005576 extracellular region, GO:0005737 cytoplasm, GO:0009986 cell surface |
| Organisms for which functions have been demonstrated | Klebsiella pneumoniae |
| Sequence length | 432 |
| FASTA sequence | >sp|B5XV19|ENO_KLEP3 Enolase OS=Klebsiella pneumoniae (strain 342) OX=507522 GN=eno PE=3 SV=1
MSKIVKVIGREIIDSRGNPTVEAEVHLEGGFVGMAAAPSGASTGSREALELRDGDKSRFL
GKGVTKAVAAVNGPIAQAILGKDAKDQAGIDKIMIDLDGTENKSNFGANAILAVSLANAK
AAAASKGLPLYAHIAELNGTPGKYSMPVPMMNIINGGEHADNNVDIQEFMIQPVGAPTLK
EAVRMGSEVFHHLAKVLKSKGMNTAVGDEGGYAPNLGSNAEALAVIAEAVKAAGYELGKD
ITLAMDCAASEFYKDGKYVLAGEGNKAFTSEEFTHFLEDLTKQYPIVSIEDGLDESDWDG
FAYQTKVLGDKIQLVGDDLFVTNTKILKEGIEKGIANSILIKFNQIGSLTETLAAIKMAK
DAGYTAVISHRSGETEDATIADLAVGTAAGQIKTGSMSRSDRVAKYNQLIRIEEALGEQA
PFNGRKEIKGQA |
| Structure Information |
| PDB ID | NA |
| Quaternary structure | component of the degradasome |
| SCOP | NA |
| CATH | NA |
| TM Helix Prediction | no TM helices |
| DisProt Annotation | not in DisProt |
| Predicted Disorder Regions | N-terminus AA 1-6, 43-51, 424-432 |
| Connections to Disease |
| OMIM ID | |
| Function 1 |
| Function description | enzyme, enolase, 2-phospho-D-glycerate => phosphoenolpyruvate + H2O Catalyzes the reversible conversion of 2-phosphoglycerate into phosphoenolpyruvate. Carbohydrate degradation, glycolysis |
| References for function | Serek, P., Lewandowski, L., Dudek, B., Pietkiewicz, J., Jermakow, K., Kapczynska, K., Krzyzewska, E., & Bednarz-Misa, I. (2021). Klebsiella pneumoniae enolase-like membrane protein interacts with human plasminogen. International journal of medical microbiology : IJMM, 311(6), 151518. https://doi.org/10.1016/j.ijmm.2021.151518 |
| E.C. number | EC:4.2.1.11 |
| Location of functional site(s) | |
| Cellular location of function | cytoplasm |
| Comments | |
| Function 2 |
| Function description | binds plasminogen |
| References for function | Serek, P., Lewandowski, L., Dudek, B., Pietkiewicz, J., Jermakow, K., Kapczynska, K., Krzyzewska, E., & Bednarz-Misa, I. (2021). Klebsiella pneumoniae enolase-like membrane protein interacts with human plasminogen. International journal of medical microbiology : IJMM, 311(6), 151518. https://doi.org/10.1016/j.ijmm.2021.151518 |
| E.C. number | |
| Location of functional site(s) | |
| Cellular location of function | cell surface |
| Comments | |