| General Information |
| MoonProt ID | 602 |
| First appeared in release | 4.0 |
| Name(s) | Glutamine synthetase |
| UniProt ID | P15103 |
| GO terms | GO:0000166 nucleotide binding
GO:0003824 catalytic activity
GO:0004356 glutamine synthetase activity
GO:0005515 protein binding
GO:0005524 ATP binding
GO:0016740 transferase activity
GO:0016874 ligase activity
GO:0019706 protein-cysteine S-palmitoyltransferase activity
GO:0046872 metal ion binding
GO:0001525 angiogenesis
GO:0006542 obsolete glutamine biosynthetic process
GO:0010594 regulation of endothelial cell migration
GO:0018345 protein palmitoylation
GO:0045648 positive regulation of erythrocyte differentiation
GO:0097275 intracellular ammonium homeostasis
GO:1903670 regulation of sprouting angiogenesis
GO:0005737 cytoplasm
GO:0005739 mitochondrion
GO:0005829 cytosol
GO:0005886 plasma membrane |
| Organisms for which functions have been demonstrated | Bos taurus |
| Sequence length | 373 |
| FASTA sequence | >sp|P15103|GLNA_BOVIN Glutamine synthetase OS=Bos taurus OX=9913 GN=GLUL PE=1 SV=4
MATSASSHLNKGIKQVYMALPQGDKVQAMYIWIDGTGEGLRCKTRTLDSEPKCIEELPEW
NFDGSSTFQSEGSNSDMYLVPAAMFRDPFRKDPNKLVFCEVFKYNRKPAETNLRHTCKRI
MDMVSNQRPWFGMEQEYTLMGTDGHPFGWPSNGFPGPQGPYYCGVGADKAYGRDIVEAHY
RACLYAGIKIGGTNAEVMPAQWEFQIGPCEGIDMGDHLWVARFILHRVCEDFGVIATFDP
KPIPGNWNGAGCHTNFSTKAMREENGLKYIEEAIEKLSKRHQYHIRAYDPKGGLDNARRL
TGFHETSNINDFSAGVANRGASIRIPRTVGQEKKGYFEDRRPSANCDPFAVTEALIRTCL
LNETGDEPFQYKN |
| Structure Information |
| PDB ID | 7U5N, 8ECY |
| Quaternary structure | NA |
| SCOP | |
| CATH | |
| TM Helix Prediction | no TM helices |
| DisProt Annotation | |
| Predicted Disorder Regions | |
| Connections to Disease |
| OMIM ID | |
| Function 1 |
| Function description | enzyme, glutamate synthetase |
| References for function | Owji, A.P., Yu, K., Kittredge, A. et al. Bestrophin-2 and glutamine synthetase form a complex for glutamate release. Nature 611, 180–187 (2022). https://doi.org/10.1038/s41586-022-05373-x |
| E.C. number | |
| Location of functional site(s) | |
| Cellular location of function | cytoplasm |
| Comments | |
| Function 2 |
| Function description | regulates opening of bestrophin-2 (BEST2), a member of the bestrophin family of calcium-activated anion channels |
| References for function | Owji, A.P., Yu, K., Kittredge, A. et al. Bestrophin-2 and glutamine synthetase form a complex for glutamate release. Nature 611, 180–187 (2022). https://doi.org/10.1038/s41586-022-05373-x |
| E.C. number | |
| Location of functional site(s) | |
| Cellular location of function | cytoplasm |
| Comments | |