| General Information |
| MoonProt ID | 604 |
| First appeared in release | 4.0 |
| Name(s) | NUP62 |
| UniProt ID | P37198 |
| GO terms | GO:0003682 chromatin binding
GO:0005515 protein binding
GO:0005543 phospholipid binding
GO:0017056 structural constituent of nuclear pore
GO:0030159 signaling receptor complex adaptor activity
GO:0030544 Hsp70 protein binding
GO:0042169 SH2 domain binding
GO:0043130 ubiquitin binding
GO:0051425 PTB domain binding
GO:0051879 Hsp90 protein binding
GO:0006405 RNA export from nucleus
GO:0006606 protein import into nucleus
GO:0006913 nucleocytoplasmic transport
GO:0007080 mitotic metaphase chromosome alignment
GO:0007098 centrosome cycle
GO:0007100 mitotic centrosome separation
GO:0007166 cell surface receptor signaling pathway
GO:0008285 negative regulation of cell population proliferation
GO:0009966 regulation of signal transduction
GO:0015031 protein transport
GO:0042059 negative regulation of epidermal growth factor receptor signaling pathway
GO:0043066 negative regulation of apoptotic process
GO:0043069 negative regulation of programmed cell death
GO:0043123 positive regulation of canonical NF-kappaB signal transduction
GO:0045742 positive regulation of epidermal growth factor receptor signaling pathway
GO:0045840 positive regulation of mitotic nuclear division
GO:0045893 positive regulation of DNA-templated transcription
GO:0046578 regulation of Ras protein signal transduction
GO:0046580 negative regulation of Ras protein signal transduction
GO:0046601 positive regulation of centriole replication
GO:0051028 mRNA transport
GO:0060236 regulation of mitotic spindle organization
GO:0098534 centriole assembly
GO:1903438 positive regulation of mitotic cytokinetic process
GO:1904781 positive regulation of protein localization to centrosome
GO:0000922 spindle pole
GO:0005635 nuclear envelope
GO:0005654 nucleoplasm
GO:0005737 cytoplasm
GO:0005813 centrosome
GO:0031965 nuclear membrane
GO:0072686 mitotic spindle
GO:0090543 Flemming body
GO:0005643 nuclear pore
GO:0044613 nuclear pore central transport channel
GO:1990904 ribonucleoprotein complex |
| Organisms for which functions have been demonstrated | Homo sapiens |
| Sequence length | 522 |
| FASTA sequence | >sp|P37198|NUP62_HUMAN Nuclear pore glycoprotein p62 OS=Homo sapiens OX=9606 GN=NUP62 PE=1 SV=3
MSGFNFGGTGAPTGGFTFGTAKTATTTPATGFSFSTSGTGGFNFGAPFQPATSTPSTGLF
SLATQTPATQTTGFTFGTATLASGGTGFSLGIGASKLNLSNTAATPAMANPSGFGLGSSN
LTNAISSTVTSSQGTAPTGFVFGPSTTSVAPATTSGGFSFTGGSTAQPSGFNIGSAGNSA
QPTAPATLPFTPATPAATTAGATQPAAPTPTATITSTGPSLFASIATAPTSSATTGLSLC
TPVTTAGAPTAGTQGFSLKAPGAASGTSTTTSTAATATATTTSSSSTTGFALNLKPLAPA
GIPSNTAAAVTAPPGPGAAAGAAASSAMTYAQLESLINKWSLELEDQERHFLQQATQVNA
WDRTLIENGEKITSLHREVEKVKLDQKRLDQELDFILSQQKELEDLLSPLEELVKEQSGT
IYLQHADEEREKTYKLAENIDAQLKRMAQDLKDIIEHLNTSGAPADTSDPLQQICKILNA
HMDSLQWIDQNSALLQRKVEEVTKVCEGRRKEQERSFRITFD |
| Structure Information |
| PDB ID | 7R5K |
| Quaternary structure | component of nuclear pore |
| SCOP | |
| CATH | |
| TM Helix Prediction | no TM helices |
| DisProt Annotation | |
| Predicted Disorder Regions | |
| Connections to Disease |
| OMIM ID | |
| Function 1 |
| Function description | component of nuclear pore |
| References for function | component of nuclear pore |
| E.C. number | |
| Location of functional site(s) | |
| Cellular location of function | nuclear membrane |
| Comments | |
| Function 2 |
| Function description | component of base of primary cilia |
| References for function | Kee, H., Dishinger, J., Lynne Blasius, T. et al. A size-exclusion permeability barrier and nucleoporins characterize a ciliary pore complex that regulates transport into cilia. Nat Cell Biol 14, 431–437 (2012). https://doi.org/10.1038/ncb2450 |
| E.C. number | |
| Location of functional site(s) | |
| Cellular location of function | |
| Comments | |