| General Information |
| MoonProt ID | 607 |
| First appeared in release | 4.0 |
| Name(s) | Pentatricopeptide repeat-containing protein At1g62590 |
| UniProt ID | Q9SXD8 |
| GO terms | GO:0004016 adenylate cyclase activity
GO:0008150 biological_process
GO:0009507 chloroplast |
| Organisms for which functions have been demonstrated | Arabidopsis thaliana |
| Sequence length | 634 |
| FASTA sequence | >sp|Q9SXD8|PPR90_ARATH Pentatricopeptide repeat-containing protein At1g62590 OS=Arabidopsis thaliana OX=3702 GN=At1g62590 PE=2 SV=1
MRISISSVVSSTTSRIVHRNLQGKGNPRIAPSSIDLCGMCYWGRAFSSGSGDYREILRNG
LHDMKLDDAIGLFGGMVKSRPLPSIVEFNKLLSAIAKMKKFDVVISLGEKMQRLEIVHGL
YTYNILINCFCRRSQISLALALLGKMMKLGYEPSIVTLSSLLNGYCHGKRISDAVALVDQ
MVEMGYRPDTITFTTLIHGLFLHNKASEAVALVDRMVQRGCQPNLVTYGVVVNGLCKRGD
TDLALNLLNKMEAAKIEADVVIFNTIIDSLCKYRHVDDALNLFKEMETKGIRPNVVTYSS
LISCLCSYGRWSDASQLLSDMIEKKINPNLVTFNALIDAFVKEGKFVEAEKLYDDMIKRS
IDPDIFTYNSLVNGFCMHDRLDKAKQMFEFMVSKDCFPDVVTYNTLIKGFCKSKRVEDGT
ELFREMSHRGLVGDTVTYTTLIQGLFHDGDCDNAQKVFKQMVSDGVPPDIMTYSILLDGL
CNNGKLEKALEVFDYMQKSEIKLDIYIYTTMIEGMCKAGKVDDGWDLFCSLSLKGVKPNV
VTYNTMISGLCSKRLLQEAYALLKKMKEDGPLPNSGTYNTLIRAHLRDGDKAASAELIRE
MRSCRFVGDASTIGLVANMLHDGRLDKSFLDMLS |
| Structure Information |
| PDB ID | NA |
| Quaternary structure | NA |
| SCOP | NA |
| CATH | NA |
| TM Helix Prediction | no TM helices |
| DisProt Annotation | |
| Predicted Disorder Regions | |
| Connections to Disease |
| OMIM ID | |
| Function 1 |
| Function description | enzyme = adenylyl cyclase |
| References for function | Chatukuta P, Dikobe TB, Kawadza DT, Sehlabane KS, Takundwa MM, Wong A, Gehring C, Ruzvidzo O. An Arabidopsis Clathrin Assembly Protein with a Predicted Role in Plant Defense Can Function as an Adenylate Cyclase. Biomolecules. 2018 Mar 23;8(2):15. doi: 10.3390/biom8020015. PMID: 29570675; PMCID: PMC6022867. |
| E.C. number | |
| Location of functional site(s) | |
| Cellular location of function | plasma membrane |
| Comments | |
| Function 2 |
| Function description | enzyme, kinase |
| References for function | Chatukuta P, Dikobe TB, Kawadza DT, Sehlabane KS, Takundwa MM, Wong A, Gehring C, Ruzvidzo O. An Arabidopsis Clathrin Assembly Protein with a Predicted Role in Plant Defense Can Function as an Adenylate Cyclase. Biomolecules. 2018 Mar 23;8(2):15. doi: 10.3390/biom8020015. PMID: 29570675; PMCID: PMC6022867. |
| E.C. number | |
| Location of functional site(s) | |
| Cellular location of function | cytoplasm |
| Comments | |