| General Information |
| MoonProt ID | 62 |
| First appeared in release | 1.0 |
| Name(s) | GAPDH
glyceraldehyde 3-phosphate dehydrogenase
Gene Name: plr
|
| UniProt ID | Q1J8I3 (Q1J8I3_STRPF) |
| GO terms | GO:0006006 glucose metabolic process
GO:0055114 oxidation-reduction process
GO:0004365 glyceraldehyde-3-phosphate dehydrogenase (NAD+) (phosphorylating) activity
GO:0016491 oxidoreductase activity
GO:0016620 oxidoreductase activity, acting on the aldehyde or oxo group of donors, NAD or NADP as acceptor
GO:0050661 NADP binding
GO:0051287 NAD binding |
| Organisms for which functions have been demonstrated | Streptococcus pyogenes serotype M4 (strain MGAS10750) (Gram positive bacterium) |
| Sequence length | 336 |
| FASTA sequence | >gi|76363879|sp|P0C0G6.2|G3P_STRPY RecName: Full=Glyceraldehyde-3-phosphate dehydrogenase; Short=GAPDH; AltName: Full=Plasmin receptor; AltName: Full=Plasminogen-binding protein
MVVKVGINGFGRIGRLAFRRIQNIEGVEVTRINDLTDPNMLAHLLKYDTTQGRFDGTVEVKEGGFEVNGNFIKVSAERDPENIDWATDGVEIVLEATGFFAKKEAAEKHLHANGAKKVVITAPGGNDVKTVVFNTNHDILDGTETVISGASCTTNCLAPMAKALHDAFGIQKGLMTTIHAYTGDQMILDGPHRGGDLRRARAGAANIVPNSTGAAKAIGLVIPELNGKLDGAAQRVPVPTGSVTELVVTLDKNVSVDEINSAMKAASNDSFGYTEDPIVSSDIVGVSYGSLFDATQTKVMEVDGSQLVKVVSWYDNEMSYTAQLVRTLEYFAKIAK |
| Structure Information |
| PDB ID | 6ITE |
| Quaternary structure | |
| SCOP | NA |
| CATH | 3.30.360.10 |
| TM Helix Prediction | no TM helices |
| DisProt Annotation | Not in DisProt |
| Predicted Disorder Regions | 1-7,333-336 |
| Connections to Disease |
| OMIM ID | |
| Function 1 |
| Function description | glyceraldehyde 3-phosphate dehydrogenase, enzyme |
| References for function | Winram SB, Lottenberg R: The plasmin-binding protein Plr of group A streptococci is identified as glyceraldehyde-3-phosphate dehydrogenase. Microbiology. 1996 Aug;142 ( Pt 8):2311-20. PMID: 8760943 |
| E.C. number | 1.2.1.12 |
| Location of functional site(s) | |
| Cellular location of function | cytoplasm |
| Comments | |
| Function 2 |
| Function description | Plasminogen binding |
| References for function | Winram SB, Lottenberg R: The plasmin-binding protein Plr of group A streptococci is identified as glyceraldehyde-3-phosphate dehydrogenase. Microbiology. 1996 Aug;142 ( Pt 8):2311-20. PMID: 8760943 |
| E.C. number | N/A |
| Location of functional site(s) | |
| Cellular location of function | cell surface |
| Comments | |