| General Information |
| MoonProt ID | 630 |
| First appeared in release | 4.0 |
| Name(s) | Homo sapiens |
| UniProt ID | Q13526 |
| GO terms | "
Gene Product GO Term
UniProtKB:Q13526 GO:0046785 microtubule polymerization
UniProtKB:Q13526 GO:0001934 positive regulation of protein phosphorylation
UniProtKB:Q13526 GO:0032465 regulation of cytokinesis
UniProtKB:Q13526 GO:0032465 regulation of cytokinesis
UniProtKB:Q13526 GO:0003755 peptidyl-prolyl cis-trans isomerase activity
UniProtKB:Q13526 GO:0003755 peptidyl-prolyl cis-trans isomerase activity
UniProtKB:Q13526 GO:0003755 peptidyl-prolyl cis-trans isomerase activity
UniProtKB:Q13526 GO:0003755 peptidyl-prolyl cis-trans isomerase activity
UniProtKB:Q13526 GO:0003755 peptidyl-prolyl cis-trans isomerase activity
UniProtKB:Q13526 GO:0003755 peptidyl-prolyl cis-trans isomerase activity
UniProtKB:Q13526 GO:0003755 peptidyl-prolyl cis-trans isomerase activity
UniProtKB:Q13526 GO:0003755 peptidyl-prolyl cis-trans isomerase activity
UniProtKB:Q13526 GO:0003755 peptidyl-prolyl cis-trans isomerase activity
UniProtKB:Q13526 GO:0003774 cytoskeletal motor activity
UniProtKB:Q13526 GO:0005515 protein binding
UniProtKB:Q13526 GO:0005515 protein binding
UniProtKB:Q13526 GO:0005515 protein binding
UniProtKB:Q13526 GO:0005515 protein binding
UniProtKB:Q13526 GO:0005515 protein binding
UniProtKB:Q13526 GO:0005515 protein binding
UniProtKB:Q13526 GO:0005515 protein binding
UniProtKB:Q13526 GO:0005515 protein binding
UniProtKB:Q13526 GO:0005515 protein binding
UniProtKB:Q13526 GO:0005515 protein binding
UniProtKB:Q13526 GO:0005515 protein bindingUniProtKB:Q13526 GO:0005515 protein binding
UniProtKB:Q13526 GO:0005515 protein binding
UniProtKB:Q13526 GO:0005515 protein binding
UniProtKB:Q13526 GO:0005515 protein binding
UniProtKB:Q13526 GO:0005515 protein binding
UniProtKB:Q13526 GO:0005515 protein binding
UniProtKB:Q13526 GO:0005515 protein binding
UniProtKB:Q13526 GO:0005515 protein binding
UniProtKB:Q13526 GO:0005515 protein binding
UniProtKB:Q13526 GO:0005515 protein binding
UniProtKB:Q13526 GO:0005515 protein binding
UniProtKB:Q13526 GO:0005515 protein binding
UniProtKB:Q13526 GO:0005515 protein binding
UniProtKB:Q13526 GO:0005515 protein binding
UniProtKB:Q13526 GO:0005515 protein binding
UniProtKB:Q13526 GO:0005515 protein binding
UniProtKB:Q13526 GO:0005515 protein binding
UniProtKB:Q13526 GO:0005515 protein binding
UniProtKB:Q13526 GO:0005515 protein binding
UniProtKB:Q13526 GO:0005515 protein binding
UniProtKB:Q13526 GO:0005515 protein binding
UniProtKB:Q13526 GO:0005515 protein binding
UniProtKB:Q13526 GO:0005515 protein binding
UniProtKB:Q13526 GO:0005515 protein binding
UniProtKB:Q13526 GO:0005515 protein binding
Gene Product GO Term
UniProtKB:Q13526 GO:0005515 protein binding
UniProtKB:Q13526 GO:0005515 protein binding
UniProtKB:Q13526 GO:0005515 protein binding
UniProtKB:Q13526 GO:0005515 protein binding
UniProtKB:Q13526 GO:0005515 protein binding
UniProtKB:Q13526 GO:0005515 protein binding
UniProtKB:Q13526 GO:0005515 protein binding
UniProtKB:Q13526 GO:0005515 protein binding
UniProtKB:Q13526 GO:0005515 protein binding
UniProtKB:Q13526 GO:0005515 protein binding
UniProtKB:Q13526 GO:0005515 protein binding
UniProtKB:Q13526 GO:0005515 protein binding
UniProtKB:Q13526 GO:0005515 protein binding
UniProtKB:Q13526 GO:0005515 protein binding
UniProtKB:Q13526 GO:0005515 protein binding
UniProtKB:Q13526 GO:0005515 protein binding
UniProtKB:Q13526 GO:0005515 protein binding
UniProtKB:Q13526 GO:0005515 protein binding
UniProtKB:Q13526 GO:0005515 protein binding
UniProtKB:Q13526 GO:0005515 protein binding
UniProtKB:Q13526 GO:0005515 protein binding
UniProtKB:Q13526 GO:0005515 protein binding
UniProtKB:Q13526 GO:0005515 protein binding
UniProtKB:Q13526 GO:0005515 protein binding
UniProtKB:Q13526 GO:0005515 protein bindingUniProtKB:Q13526 GO:0005515 protein binding
UniProtKB:Q13526 GO:0005515 protein binding
UniProtKB:Q13526 GO:0005515 protein binding
UniProtKB:Q13526 GO:0005515 protein binding
UniProtKB:Q13526 GO:0005515 protein binding
UniProtKB:Q13526 GO:0005515 protein binding
UniProtKB:Q13526 GO:0005515 protein binding
UniProtKB:Q13526 GO:0005515 protein binding
UniProtKB:Q13526 GO:0005515 protein binding
UniProtKB:Q13526 GO:0005515 protein binding
UniProtKB:Q13526 GO:0005515 protein binding
UniProtKB:Q13526 GO:0005515 protein binding
UniProtKB:Q13526 GO:0005515 protein binding
UniProtKB:Q13526 GO:0005515 protein binding
UniProtKB:Q13526 GO:0005515 protein binding
UniProtKB:Q13526 GO:0005515 protein binding
UniProtKB:Q13526 GO:0005515 protein binding
UniProtKB:Q13526 GO:0005515 protein binding
UniProtKB:Q13526 GO:0005515 protein binding
UniProtKB:Q13526 GO:0005515 protein binding
UniProtKB:Q13526 GO:0005515 protein binding
UniProtKB:Q13526 GO:0005515 protein binding
UniProtKB:Q13526 GO:0005515 protein binding
UniProtKB:Q13526 GO:0005515 protein binding
UniProtKB:Q13526 GO:0005515 protein binding
Gene Product GO Term
UniProtKB:Q13526 GO:0005515 protein binding
UniProtKB:Q13526 GO:0005515 protein binding
UniProtKB:Q13526 GO:0005515 protein binding
UniProtKB:Q13526 GO:0005515 protein binding
UniProtKB:Q13526 GO:0005515 protein binding
UniProtKB:Q13526 GO:0005515 protein binding
UniProtKB:Q13526 GO:0005515 protein binding
UniProtKB:Q13526 GO:0005515 protein binding
UniProtKB:Q13526 GO:0005515 protein binding
UniProtKB:Q13526 GO:0005515 protein binding
UniProtKB:Q13526 GO:0005515 protein binding
UniProtKB:Q13526 GO:0005515 protein binding
UniProtKB:Q13526 GO:0005515 protein binding
UniProtKB:Q13526 GO:0005515 protein binding
UniProtKB:Q13526 GO:0005515 protein binding
UniProtKB:Q13526 GO:0005515 protein binding
UniProtKB:Q13526 GO:0005515 protein binding
UniProtKB:Q13526 GO:0005515 protein binding
UniProtKB:Q13526 GO:0005515 protein binding
UniProtKB:Q13526 GO:0005515 protein binding
UniProtKB:Q13526 GO:0005515 protein binding
UniProtKB:Q13526 GO:0005515 protein binding
UniProtKB:Q13526 GO:0005515 protein binding
UniProtKB:Q13526 GO:0005515 protein binding
UniProtKB:Q13526 GO:0005515 protein bindingUniProtKB:Q13526 GO:0005515 protein binding
UniProtKB:Q13526 GO:0005515 protein binding
UniProtKB:Q13526 GO:0005515 protein binding
UniProtKB:Q13526 GO:0005515 protein binding
UniProtKB:Q13526 GO:0005515 protein binding
UniProtKB:Q13526 GO:0005515 protein binding
UniProtKB:Q13526 GO:0005515 protein binding
UniProtKB:Q13526 GO:0005515 protein binding
UniProtKB:Q13526 GO:0005515 protein binding
UniProtKB:Q13526 GO:0005515 protein binding
UniProtKB:Q13526 GO:0005515 protein binding
UniProtKB:Q13526 GO:0005515 protein binding
UniProtKB:Q13526 GO:0005515 protein binding
UniProtKB:Q13526 GO:0005515 protein binding
UniProtKB:Q13526 GO:0005515 protein binding
UniProtKB:Q13526 GO:0005515 protein binding
UniProtKB:Q13526 GO:0005515 protein binding
UniProtKB:Q13526 GO:0005515 protein binding
UniProtKB:Q13526 GO:0005515 protein binding
UniProtKB:Q13526 GO:0005515 protein binding
UniProtKB:Q13526 GO:0005515 protein binding
UniProtKB:Q13526 GO:0005515 protein binding
UniProtKB:Q13526 GO:0005515 protein binding
UniProtKB:Q13526 GO:0005515 protein binding
UniProtKB:Q13526 GO:0005515 protein bindingUniProtKB:Q13526 GO:0005515 protein binding
UniProtKB:Q13526 GO:0005515 protein binding
UniProtKB:Q13526 GO:0005515 protein binding
UniProtKB:Q13526 GO:0005515 protein binding
UniProtKB:Q13526 GO:0005515 protein binding
UniProtKB:Q13526 GO:0005515 protein binding
UniProtKB:Q13526 GO:0005515 protein binding
UniProtKB:Q13526 GO:0005515 protein binding
UniProtKB:Q13526 GO:0005515 protein binding
UniProtKB:Q13526 GO:0005515 protein binding
UniProtKB:Q13526 GO:0005515 protein binding
UniProtKB:Q13526 GO:0005515 protein binding
UniProtKB:Q13526 GO:0005515 protein binding
UniProtKB:Q13526 GO:0005515 protein binding
UniProtKB:Q13526 GO:0005515 protein binding
UniProtKB:Q13526 GO:0005515 protein binding
UniProtKB:Q13526 GO:0005515 protein binding
UniProtKB:Q13526 GO:0005515 protein binding
UniProtKB:Q13526 GO:0005515 protein binding
UniProtKB:Q13526 GO:0005515 protein binding
UniProtKB:Q13526 GO:0005515 protein binding
UniProtKB:Q13526 GO:0005515 protein binding
UniProtKB:Q13526 GO:0005515 protein binding
UniProtKB:Q13526 GO:0005515 protein binding
UniProtKB:Q13526 GO:0005515 protein bindingUniProtKB:Q13526 GO:0005515 protein binding
UniProtKB:Q13526 GO:0005515 protein binding
UniProtKB:Q13526 GO:0005515 protein binding
UniProtKB:Q13526 GO:0005515 protein binding
UniProtKB:Q13526 GO:0005515 protein binding
UniProtKB:Q13526 GO:0005515 protein binding
UniProtKB:Q13526 GO:0005515 protein binding
UniProtKB:Q13526 GO:0005515 protein binding
UniProtKB:Q13526 GO:0005515 protein binding
UniProtKB:Q13526 GO:0005515 protein binding
UniProtKB:Q13526 GO:0005515 protein binding
UniProtKB:Q13526 GO:0005515 protein binding
UniProtKB:Q13526 GO:0005515 protein binding
UniProtKB:Q13526 GO:0005515 protein binding
UniProtKB:Q13526 GO:0005515 protein binding
UniProtKB:Q13526 GO:0005515 protein binding
UniProtKB:Q13526 GO:0005515 protein binding
UniProtKB:Q13526 GO:0005515 protein binding
UniProtKB:Q13526 GO:0005515 protein binding
UniProtKB:Q13526 GO:0005515 protein binding
UniProtKB:Q13526 GO:0005515 protein binding
UniProtKB:Q13526 GO:0005515 protein binding
UniProtKB:Q13526 GO:0005515 protein binding
UniProtKB:Q13526 GO:0005515 protein binding
UniProtKB:Q13526 GO:0005515 protein bindingUniProtKB:Q13526 GO:0005515 protein binding
UniProtKB:Q13526 GO:0005515 protein binding
UniProtKB:Q13526 GO:0005515 protein binding
UniProtKB:Q13526 GO:0005515 protein binding
UniProtKB:Q13526 GO:0005515 protein binding
UniProtKB:Q13526 GO:0005515 protein binding
UniProtKB:Q13526 GO:0005515 protein binding
UniProtKB:Q13526 GO:0005515 protein binding
UniProtKB:Q13526 GO:0005515 protein binding
UniProtKB:Q13526 GO:0005515 protein binding
UniProtKB:Q13526 GO:0005515 protein binding
UniProtKB:Q13526 GO:0005515 protein binding
UniProtKB:Q13526 GO:0005515 protein binding
UniProtKB:Q13526 GO:0005515 protein binding
UniProtKB:Q13526 GO:0005515 protein binding
UniProtKB:Q13526 GO:0005515 protein binding
UniProtKB:Q13526 GO:0005515 protein binding
UniProtKB:Q13526 GO:0005515 protein binding
UniProtKB:Q13526 GO:0005515 protein binding
UniProtKB:Q13526 GO:0005515 protein binding
UniProtKB:Q13526 GO:0005515 protein binding
UniProtKB:Q13526 GO:0005515 protein binding
UniProtKB:Q13526 GO:0008013 beta-catenin binding
UniProtKB:Q13526 GO:0008013 beta-catenin binding
UniProtKB:Q13526 GO:0008013 beta-catenin bindingUniProtKB:Q13526 GO:0016853 isomerase activity
UniProtKB:Q13526 GO:0016859 cis-trans isomerase activity
UniProtKB:Q13526 GO:0031434 mitogen-activated protein kinase kinase binding
UniProtKB:Q13526 GO:0032794 GTPase activating protein binding
UniProtKB:Q13526 GO:0048156 tau protein binding
UniProtKB:Q13526 GO:0050815 phosphoserine residue binding
UniProtKB:Q13526 GO:0050815 phosphoserine residue binding
UniProtKB:Q13526 GO:0050816 phosphothreonine residue binding
UniProtKB:Q13526 GO:0050816 phosphothreonine residue binding
UniProtKB:Q13526 GO:0051219 phosphoprotein binding
UniProtKB:Q13526 GO:0051219 phosphoprotein binding
UniProtKB:Q13526 GO:1990757 ubiquitin ligase activator activity
UniProtKB:Q13526 GO:0000413 protein peptidyl-prolyl isomerization
UniProtKB:Q13526 GO:0001666 response to hypoxia
UniProtKB:Q13526 GO:0006626 protein targeting to mitochondrion
UniProtKB:Q13526 GO:0007088 regulation of mitotic nuclear division
UniProtKB:Q13526 GO:0007266 Rho protein signal transduction
UniProtKB:Q13526 GO:0010468 regulation of gene expression
UniProtKB:Q13526 GO:0030182 neuron differentiation
UniProtKB:Q13526 GO:0030512 negative regulation of transforming growth factor beta receptor signaling pathway
UniProtKB:Q13526 GO:0031647 regulation of protein stability
UniProtKB:Q13526 GO:0031648 protein destabilization
UniProtKB:Q13526 GO:0032465 regulation of cytokinesis
UniProtKB:Q13526 GO:0042177 negative regulation of protein catabolic process
UniProtKB:Q13526 GO:0045944 positive regulation of transcription by RNA polymerase IIUniProtKB:Q13526 GO:0050808 synapse organization
UniProtKB:Q13526 GO:0050821 protein stabilization
UniProtKB:Q13526 GO:0050821 protein stabilization
UniProtKB:Q13526 GO:0050821 protein stabilization
UniProtKB:Q13526 GO:0060392 negative regulation of SMAD protein signal transduction
UniProtKB:Q13526 GO:0060392 negative regulation of SMAD protein signal transduction
UniProtKB:Q13526 GO:0070373 negative regulation of ERK1 and ERK2 cascade
UniProtKB:Q13526 GO:0071456 cellular response to hypoxia
UniProtKB:Q13526 GO:0090263 positive regulation of canonical Wnt signaling pathway
UniProtKB:Q13526 GO:0090263 positive regulation of canonical Wnt signaling pathway
UniProtKB:Q13526 GO:1900180 regulation of protein localization to nucleus
UniProtKB:Q13526 GO:1902430 negative regulation of amyloid-beta formation
UniProtKB:Q13526 GO:1902430 negative regulation of amyloid-beta formation
UniProtKB:Q13526 GO:1902430 negative regulation of amyloid-beta formation
UniProtKB:Q13526 GO:1903444 negative regulation of brown fat cell differentiation
UniProtKB:Q13526 GO:2000146 negative regulation of cell motility
UniProtKB:Q13526 GO:0005634 nucleus
UniProtKB:Q13526 GO:0005829 cytosol
UniProtKB:Q13526 GO:0098978 glutamatergic synapse
UniProtKB:Q13526 GO:0098978 glutamatergic synapse
UniProtKB:Q13526 GO:0098978 glutamatergic synapse
UniProtKB:Q13526 GO:0098978 glutamatergic synapse
UniProtKB:Q13526 GO:0098978 glutamatergic synapse
UniProtKB:Q13526 GO:0099524 postsynaptic cytosol
UniProtKB:Q13526 GO:0099524 postsynaptic cytosolUniProtKB:Q13526 GO:0099524 postsynaptic cytosol
UniProtKB:Q13526 GO:0099524 postsynaptic cytosol
UniProtKB:Q13526 GO:0099524 postsynaptic cytosol
UniProtKB:Q13526 GO:0005634 nucleus
UniProtKB:Q13526 GO:0005634 nucleus
UniProtKB:Q13526 GO:0005634 nucleus
UniProtKB:Q13526 GO:0005634 nucleus
UniProtKB:Q13526 GO:0005634 nucleus
UniProtKB:Q13526 GO:0005634 nucleus
UniProtKB:Q13526 GO:0005654 nucleoplasm
UniProtKB:Q13526 GO:0005654 nucleoplasm
UniProtKB:Q13526 GO:0005654 nucleoplasm
UniProtKB:Q13526 GO:0005654 nucleoplasm
UniProtKB:Q13526 GO:0005654 nucleoplasm
UniProtKB:Q13526 GO:0005654 nucleoplasm
UniProtKB:Q13526 GO:0005737 cytoplasm
UniProtKB:Q13526 GO:0005737 cytoplasm
UniProtKB:Q13526 GO:0005737 cytoplasm
UniProtKB:Q13526 GO:0005829 cytosol
UniProtKB:Q13526 GO:0005829 cytosol
UniProtKB:Q13526 GO:0005829 cytosol
UniProtKB:Q13526 GO:0005829 cytosol
UniProtKB:Q13526 GO:0005829 cytosol
UniProtKB:Q13526 GO:0016607 nuclear speck
UniProtKB:Q13526 GO:0030496 midbodyUniProtKB:Q13526 GO:0036064 ciliary basal body
UniProtKB:Q13526 GO:0036064 ciliary basal body
UniProtKB:Q13526 GO:0098978 glutamatergic synapse" |
| Organisms for which functions have been demonstrated | Homo sapiens |
| Sequence length | 163.0 |
| FASTA sequence | >sp|Q13526|PIN1_HUMAN Peptidyl-prolyl cis-trans isomerase NIMA-interacting 1 OS=Homo sapiens OX=9606 GN=PIN1 PE=1 SV=1 MADEEKLPPGWEKRMSRSSGRVYYFNHITNASQWERPSGNSSSGGKNGQGEPARVRCSHL LVKHSQSRRPSSWRQEKITRTKEEALELINGYIQKIKSGEEDFESLASQFSDCSSAKARG DLGAFSRGQMQKPFEDASFALRTGEMSGPVFTDSGIHIILRTE |
| Structure Information |
| PDB ID | NA |
| Quaternary structure | NA |
| SCOP | |
| CATH | |
| TM Helix Prediction | no TM helices |
| DisProt Annotation | |
| Predicted Disorder Regions | Predicted disorder at N terminus (aa 1-11), middle region (aa 34-77), and C terminus (aa 156-163) |
| Connections to Disease |
| OMIM ID | |
| Function 1 |
| Function description | enzyme, peptidyl-prolyl isomerase |
| References for function | Chen XR, Dixit K, Yang Y, McDermott MI, Imam HT, Bankaitis VA, Igumenova TI. A novel bivalent interaction mode underlies a non-catalytic mechanism for Pin1-mediated protein kinase C regulation. Elife. 2024 Apr 30;13:e92884. doi: 10.7554/eLife.92884. PMID: 38687676; PMCID: PMC11060717. |
| E.C. number | 5.2.1.8 |
| Location of functional site(s) | |
| Cellular location of function | cytoplasm |
| Comments | |
| Function 2 |
| Function description | binds protein kinase C (PKC) and regulates its stability (chaperone-like activity) |
| References for function | Chen XR, Dixit K, Yang Y, McDermott MI, Imam HT, Bankaitis VA, Igumenova TI. A novel bivalent interaction mode underlies a non-catalytic mechanism for Pin1-mediated protein kinase C regulation. Elife. 2024 Apr 30;13:e92884. doi: 10.7554/eLife.92884. PMID: 38687676; PMCID: PMC11060717. |
| E.C. number | |
| Location of functional site(s) | |
| Cellular location of function | cytoplasm |
| Comments | |