| General Information |
| MoonProt ID | 638 |
| First appeared in release | 4.0 |
| Name(s) | Lactobacillus acidophilus (strain ATCC 700396 / NCK56 / N2 / NCFM) |
| UniProt ID | Q5FKR8 |
| GO terms | GO:0000166 nucleotide binding GO:0000287 magnesium ion binding GO:0003746 translation elongation factor activity GO:0003924 GTPase activity GO:0005525 GTP binding GO:0016787 hydrolase activity GO:0046872 metal ion binding GO:0006412 translation GO:0006414 translational elongation GO:0005737 cytoplasm GO:0005829 cytosol |
| Organisms for which functions have been demonstrated | Lactobacillus acidophilus (strain ATCC 700396 / NCK56 / N2 / NCFM) |
| Sequence length | 396.0 |
| FASTA sequence | ">sp|Q5FKR8|EFTU_LACAC Elongation factor Tu OS=Lactobacillus acidophilus (strain ATCC 700396 / NCK56 / N2 / NCFM) OX=272621 GN=tuf PE=3 SV=1
MAEKEHYVRTKPHVNIGTIGHVDHGKTTLTAAITTVLAEKGLAKAEDYSQIDAAPEEKER
GITINTAHVEYETENRHYAHMDAPGHADYIKNMITGAAQMDGAILVVAATDGPMPQTREH
ILLARQVGVNYIVVFLNKCDLVDDPELIDLVEMEVRDLLTEYDYPGDDIPVVRGSALKAL
QGDKEAQDQIMKLMDIVDEYIPTPERQTDKPFLMPVEDVFTITGRGTVASGRIDRGTVKV
GDEVEIVGLVDKVLKSVVTGLEMFHKTLDLGEAGDNVGVLLRGVDRDQVVRGQVLAAPGS
IQTHKKFKAQVYVLKKDEGGRHTPFFSDYRPQFYFHTTDITGEIELPEGTEMVMPGDNTE
FTVTLIKPAAIEKGTKFTIREGGRTVGAGQVTEILD" |
| Structure Information |
| PDB ID | NA |
| Quaternary structure | NA |
| SCOP | |
| CATH | |
| TM Helix Prediction | no TM helices |
| DisProt Annotation | |
| Predicted Disorder Regions | |
| Connections to Disease |
| OMIM ID | |
| Function 1 |
| Function description | elongation factor |
| References for function | _ |
| E.C. number | EC:3.6.5.3 |
| Location of functional site(s) | |
| Cellular location of function | cytoplasm |
| Comments | |
| Function 2 |
| Function description | adhesin |
| References for function | Celebioglu HU, Olesen SV, Prehn K, Lahtinen SJ, Brix S, Abou Hachem M, Svensson B. Mucin- and carbohydrate-stimulated adhesion and subproteome changes of the probiotic bacterium Lactobacillus acidophilus NCFM. J Proteomics. 2017 Jun 23;163:102-110. doi: 10.1016/j.jprot.2017.05.015. Epub 2017 May 19. PMID: 28533178. |
| E.C. number | |
| Location of functional site(s) | |
| Cellular location of function | cell surface |
| Comments | |