| General Information |
| MoonProt ID | 91 |
| First appeared in release | 1.0 |
| Name(s) | Phosphoglyceromutase
GPM1
Phosphoglycerate mutase
PGAM
BPG-dependent PGAM
MPGM
Gene Name: GPM1 |
| UniProt ID | P82612 (PMGY_CANAL), Reviewed |
| GO terms | GO:0006096 glycolysis
GO:0008150 biological_process
GO:0008152 metabolic process
GO:0051701 interaction with host
GO:0003674 molecular_function
GO:0003824 catalytic activity
GO:0004619 phosphoglycerate mutase activity
GO:0005515 protein binding
GO:0016853 isomerase activity
GO:0016868 intramolecular transferase activity, phosphotransferases
GO:0005575 cellular_component
GO:0005737 cytoplasm
GO:0009277 fungal-type cell wall
GO:0009986 cell surface
GO:0030446 hyphal cell wall |
| Organisms for which functions have been demonstrated | Candida albicans (yeast, a fungi, can cause candiadiasis) |
| Sequence length | 248 |
| FASTA sequence | >gi|229463024|sp|P82612.3|PMGY_CANAL RecName: Full=Phosphoglycerate mutase; Short=PGAM; AltName: Full=BPG-dependent PGAM; AltName: Full=MPGM; AltName: Full=Phosphoglyceromutase
MPKLVLVRHGQSEWNEKNLFTGWVDVRLSETGQKEAKRAGELLKEAGINVDVLHTSKLSRAIQTANIALDAADQLYVPVKRSWRLNERHYGALQGKDKAQTLEAYGQEKFQIWRRSFDVPPPKIDPKDEYSQVGDRRYADVDPAVVPLTESLALVIDRLLPYWQDEIAGDLLAGKVVLIAAHGNSLRALVKHLDNISDEDIAGLNIPTGIPLVYELDENLKPTKPSYYLDPEAAAAGAAAVAAQGQKK |
| Structure Information |
| PDB ID | closest is Saccharomyces with 78% amino acid sequence identity |
| Quaternary structure | |
| SCOP | NA |
| CATH | NA |
| TM Helix Prediction | no TM helices |
| DisProt Annotation | Not in DisProt |
| Predicted Disorder Regions | Predicted disorder at N terminus (aa 1-7), middle region (aa 121-132), and C terminus (aa 241-248) |
| Connections to Disease |
| OMIM ID | |
| Function 1 |
| Function description | Phosphoglyceromutase, enzyme
1,3-bisphosphoglycerate <=> 2,3-bisphosphoglycerate
Carbohydrate degradation, glycolysis |
| References for function | |
| E.C. number | 5.4.2.1 |
| Location of functional site(s) | |
| Cellular location of function | cytoplasm |
| Comments | |
| Function 2 |
| Function description | plasminogen binding |
| References for function | Crowe, J.D. et al. (2003) Candida albicans binds human plasminogen:
identification of eight plasminogen-binding proteins. Mol Microbiol. 2003 Mar;47(6):1637-51. PMID: 12622818 |
| E.C. number | N/A |
| Location of functional site(s) | |
| Cellular location of function | cell surface |
| Comments | |