| General Information |
| MoonProt ID | 95 |
| First appeared in release | 1.0 |
| Name(s) | Transcription elongation factor
TEF1
Elongation factor 1-alpha 1
EF-1-alpha 1
Gene Name: TEF1
|
| UniProt ID | P0CY35 (EF1A1_CANAL), Reviewed |
| GO terms | GO:0006184 GTP catabolic process
GO:0006412 translation
GO:0006414 translational elongation
GO:0006415 translational termination
GO:0051701 interaction with host
GO:0000166 nucleotide binding
GO:0003746 translation elongation factor activity
GO:0003747 translation release factor activity
GO:0003924 GTPase activity
GO:0005515 protein binding
GO:0005525 GTP binding
GO:0009277 fungal-type cell wall
GO:0009986 cell surface
GO:0022626 cytosolic ribosome
GO:0030445 yeast-form cell wall
GO:0030446 hyphal cell wall |
| Organisms for which functions have been demonstrated | Candida albicans (yeast, a fungi, can cause candiadiasis) |
| Sequence length | 458 |
| FASTA sequence | >sp|P0CY35|EF1A1_CANAL Elongation factor 1-alpha 1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=TEF1 PE=3 SV=1
MGKEKTHVNVVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAAELGKGSFKYAWVLDKLKAERERGITIDIALWKFETPKYHVTVIDAPGHRDFIKNMITGTSQADCAILIIAGGTGEFEAGISKDGQTREHALLAYTLGVKQLIVAVNKMDSVKWDKNRFEEIIKETSNFVKKVGYNPKTVPFVPISGWNGDNMIEPSTNCPWYKGWEKETKSGKVTGKTLLEAIDAIEPPTRPTDKPLRLPLQDVYKIGGIGTVPVGRVETGIIKAGMVVTFAPAGVTTEVKSVEMHHEQLAEGVPGDNVGFNVKNVSVKEIRRGNVCGDSKNDPPKGCDSFNAQVIVLNHPGQISAGYSPVLDCHTAHIACKFDTLVEKIDRRTGKKLEENPKFVKSGDAAIVKMVPTKPMCVEAFTDYPPLGRFAVRDMRQTVAVGVIKSVEKSDKAGKVTKAAQKAAKK
|
| Structure Information |
| PDB ID | closest is Saccharomyces with 91% amino acid sequence identity |
| Quaternary structure | |
| SCOP | NA |
| CATH | NA |
| TM Helix Prediction | no TM helices |
| DisProt Annotation | Not in DisProt |
| Predicted Disorder Regions | 1-7, 324-330, 379-387, 442-458 |
| Connections to Disease |
| OMIM ID | |
| Function 1 |
| Function description | Transcription elongation factor
during protein biosynthesis, TEF1 promotes the GTP-dependent binding of aminoacyl-tRNA to the A-site of the ribosome |
| References for function | |
| E.C. number | N/A |
| Location of functional site(s) | |
| Cellular location of function | cytoplasm |
| Comments | |
| Function 2 |
| Function description | plasminogen binding |
| References for function | Crowe, J.D. et al. (2003) Candida albicans binds human plasminogen:
identification of eight plasminogen-binding proteins. Mol Microbiol. 2003 Mar;47(6):1637-51. PMID: 12622818 |
| E.C. number | N/A |
| Location of functional site(s) | |
| Cellular location of function | cell surface |
| Comments | |