General Information |
MoonProt ID | 97 |
First appeared in release | 1.0 |
Name(s) | Thiol-specific antioxidant protein
TSA1
Peroxiredoxin TSA1
Thioredoxin peroxidase
Gene Name: TSA1
|
UniProt ID | Q9Y7F0 (TSA1_CANAL), Reviewed |
GO terms | GO:0030447 filamentous growth
GO:0031505 fungal-type cell wall organization
GO:0034599 cellular response to oxidative stress
GO:0036170 filamentous growth of a population of unicellular organisms in response to starvation
GO:0036171 filamentous growth of a population of unicellular organisms in response to chemical stimulus
GO:0042542 response to hydrogen peroxide
GO:0042744 hydrogen peroxide catabolic process
GO:0051701 interaction with host
GO:0055114 oxidation-reduction process
GO:0070301 cellular response to hydrogen peroxide
GO:0004601 peroxidase activity
GO:0005515 protein binding
GO:0008379 thioredoxin peroxidase activity
GO:0016209 antioxidant activity
GO:0016491 oxidoreductase activity
GO:0030985 high molecular weight kininogen binding
GO:0051920 peroxiredoxin activity
GO:0005634 nucleus
GO:0005737 cytoplasm
GO:0030446 hyphal cell wall
GO:0009277 fungal-type cell wall
GO:0009986 cell surface |
Organisms for which functions have been demonstrated | Candida albicans (yeast, a fungi, can cause candiadiasis) |
Sequence length | 196 |
FASTA sequence | >sp|Q9Y7F0|TSA1_CANAL Peroxiredoxin TSA1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=TSA1 PE=2 SV=1
MAPVVQQPAPSFKKTAVVDGVFEEVTLEQYKGKWVLLAFIPLAFTFVCPSEIIAYSEAVKKFAEKDAQVLFASTDSEYTWLAWTNVARKDGGIGKVDFPVLADTNHSLSRDYGVLIEEEGVALRGIFLIDPKGVLRQITINDLPVGRSVEESLRLLEAFQFTEKYGEVCPANWHPGDETIKPSPEASKEYFNKVNK
|
Structure Information |
PDB ID | closest is Saccharomyces with 73% amino acid sequence identity |
Quaternary structure | |
SCOP | NA |
CATH | NA |
TM Helix Prediction | no TM helices |
DisProt Annotation | Not in DisProt |
Predicted Disorder Regions | 1-3, 192-196 |
Connections to Disease |
OMIM ID | |
Function 1 |
Function description | Thiol-specific antioxidant protein
antioxidant
2 R'-SH + ROOH = R'-S-S-R' + H2O + ROH.
|
References for function | |
E.C. number | N/A |
Location of functional site(s) | |
Cellular location of function | cytoplasm |
Comments | |
Function 2 |
Function description | plasminogen binding |
References for function | Crowe, J.D. et al. (2003) Candida albicans binds human plasminogen:
identification of eight plasminogen-binding proteins. Mol Microbiol. 2003 Mar;47(6):1637-51. PMID: 12622818 |
E.C. number | N/A |
Location of functional site(s) | |
Cellular location of function | cell surface |
Comments | |