| General Information |
| MoonProt ID | 97 |
| First appeared in release | 1.0 |
| Name(s) | Thiol-specific antioxidant protein
TSA1
Peroxiredoxin TSA1
Thioredoxin peroxidase
Gene Name: TSA1
|
| UniProt ID | Q9Y7F0 (TSA1_CANAL), Reviewed |
| GO terms | GO:0030447 filamentous growth
GO:0031505 fungal-type cell wall organization
GO:0034599 cellular response to oxidative stress
GO:0036170 filamentous growth of a population of unicellular organisms in response to starvation
GO:0036171 filamentous growth of a population of unicellular organisms in response to chemical stimulus
GO:0042542 response to hydrogen peroxide
GO:0042744 hydrogen peroxide catabolic process
GO:0051701 interaction with host
GO:0055114 oxidation-reduction process
GO:0070301 cellular response to hydrogen peroxide
GO:0004601 peroxidase activity
GO:0005515 protein binding
GO:0008379 thioredoxin peroxidase activity
GO:0016209 antioxidant activity
GO:0016491 oxidoreductase activity
GO:0030985 high molecular weight kininogen binding
GO:0051920 peroxiredoxin activity
GO:0005634 nucleus
GO:0005737 cytoplasm
GO:0030446 hyphal cell wall
GO:0009277 fungal-type cell wall
GO:0009986 cell surface |
| Organisms for which functions have been demonstrated | Candida albicans (yeast, a fungi, can cause candiadiasis) |
| Sequence length | 196 |
| FASTA sequence | >sp|Q9Y7F0|TSA1_CANAL Peroxiredoxin TSA1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=TSA1 PE=2 SV=1
MAPVVQQPAPSFKKTAVVDGVFEEVTLEQYKGKWVLLAFIPLAFTFVCPSEIIAYSEAVKKFAEKDAQVLFASTDSEYTWLAWTNVARKDGGIGKVDFPVLADTNHSLSRDYGVLIEEEGVALRGIFLIDPKGVLRQITINDLPVGRSVEESLRLLEAFQFTEKYGEVCPANWHPGDETIKPSPEASKEYFNKVNK
|
| Structure Information |
| PDB ID | closest is Saccharomyces with 73% amino acid sequence identity |
| Quaternary structure | |
| SCOP | NA |
| CATH | NA |
| TM Helix Prediction | no TM helices |
| DisProt Annotation | Not in DisProt |
| Predicted Disorder Regions | Predicted disorder at N terminus (aa 1-6), and C terminus (aa 176-196) |
| Connections to Disease |
| OMIM ID | |
| Function 1 |
| Function description | Thiol-specific antioxidant protein
antioxidant
2 R'-SH + ROOH = R'-S-S-R' + H2O + ROH.
|
| References for function | |
| E.C. number | N/A |
| Location of functional site(s) | |
| Cellular location of function | cytoplasm |
| Comments | |
| Function 2 |
| Function description | plasminogen binding |
| References for function | Crowe, J.D. et al. (2003) Candida albicans binds human plasminogen:
identification of eight plasminogen-binding proteins. Mol Microbiol. 2003 Mar;47(6):1637-51. PMID: 12622818 |
| E.C. number | N/A |
| Location of functional site(s) | |
| Cellular location of function | cell surface |
| Comments | |